DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and dpr1

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:306 Identity:88/306 - (28%)
Similarity:126/306 - (41%) Gaps:83/306 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 LLPRRQLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQ 259
            |||.....: |.|.||..||..:|.|::.:...|.:||:|.||.||:....||:.:|.||..|. 
  Fly    51 LLPYFDFDV-PRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLR- 113

  Fly   260 STTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLA 324
                                           |.|       |.:|||||||....|:|.||||:.
  Fly   114 -------------------------------PDG-------SANWTLQIKYPQPRDSGVYECQIN 140

  Fly   325 TEPKMSAKVQLFVITPRTELIGDRQRFVKAGSRVELHC-IVRGTLEAPKYIFWYRGDQQV--TAE 386
            ||||||......|:..:.|:.|.....||.||.:.|.| |::|..|... ||||:|.:.:  ..|
  Fly   141 TEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGN-IFWYKGSEMLDGKGE 204

  Fly   387 NEASGA------QSGW------YTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSA 439
            ||...:      :..|      ..:|.|.:.|.|                    |||||.|..:.
  Fly   205 NEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDT--------------------GNYTCVPTVAK 249

  Fly   440 AASMQLHVLSGEYSASAIKSTAARPHRLGHGYTSLHQWLIFLLVAL 485
            .:|:.:||:.||:       .||..|.......|.:..:..:|:::
  Fly   250 TSSVYVHVIIGEH-------PAAMQHNSSSNSNSFYCGICCMLLSI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 44/131 (34%)
Ig <298..338 CDD:299845 20/39 (51%)
IG_like 352..447 CDD:214653 29/109 (27%)
Ig 358..439 CDD:143165 24/95 (25%)
dpr1NP_001286645.1 Ig 59..154 CDD:299845 44/134 (33%)
IG_like 60..150 CDD:214653 44/128 (34%)
IG_like 163..257 CDD:214653 29/114 (25%)
Ig 174..244 CDD:143165 22/90 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.