DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and dpr9

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:470 Identity:110/470 - (23%)
Similarity:163/470 - (34%) Gaps:156/470 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GAGGTPGGRGAGILAGSGRSPGTASILLAFLAAVSFRGMRA--------PLAATATPMENASLIA 71
            |.||:..|      ||...:||...|      ..|..|..:        |.|.:....|:|:|  
  Fly   149 GVGGSAAG------AGEAAAPGPTGI------DGSGSGNNSSGNNKNGHPAAGSGAASESAAL-- 199

  Fly    72 SPATGTSTMGSAGSPVLMLGDDQQQQEYDTTVVDSWSDRPDTATLTKGFSIPSYLPPFPEFIPAD 136
               |..::..|.|....:.|                                         ||:.
  Fly   200 ---TTDASRSSVGGATTITG-----------------------------------------IPSS 220

  Fly   137 LPHMLRNASSGAAPPADIGPSGSPMPSKPNEQSRLHAYDSEQKAQQLRREKELAKERELLPRRQL 201
            ..|...:|||                         :.:.|:..:...|...:|.:.|...|....
  Fly   221 SLHKASSASS-------------------------NTFSSQLASGFHRNSIDLEEARNAGPYFDK 260

  Fly   202 SLPPLNATVQAGQHAYLPCKLNQHSGKPL----SWVRLRDEHIIAVDHTTFINDARFASLLQSTT 262
            :... |.|...|:.|||.|::.....|.:    ||||.||.|::.|...|:.:|.||.::.|..|
  Fly   261 AFSK-NVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRYTYTSDQRFRAIHQPQT 324

  Fly   263 LTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEP 327
                                                   ..|.|||||....|:|.||||::|.|
  Fly   325 ---------------------------------------EDWMLQIKYPQHRDSGIYECQVSTTP 350

  Fly   328 KMSAKVQLFVITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGD------QQVTAE 386
            .||..:.|.|:.|.||:||....::::||.:.|.||::.:.|.|.||||...:      |.:..:
  Fly   351 HMSHYIHLNVVEPSTEIIGAPDLYIESGSTINLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYD 415

  Fly   387 NEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHVLSG- 450
            :...|            :...|.....|...|:|...|...||:|.|.|.|:...|:.:|||:| 
  Fly   416 SPRGG------------VSVVTNKGDTTTSFLLIKSARPSDSGHYQCNPSNAKPKSVTVHVLNGV 468

  Fly   451 --EYSASAIKSTAAR 463
              ..|.....|.|||
  Fly   469 SHSVSRGVPSSNAAR 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 39/135 (29%)
Ig <298..338 CDD:299845 17/39 (44%)
IG_like 352..447 CDD:214653 25/100 (25%)
Ig 358..439 CDD:143165 22/86 (26%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 39/137 (28%)
IG_like 263..360 CDD:214653 39/136 (29%)
IG_like 371..464 CDD:214653 25/104 (24%)
IGc2 377..456 CDD:197706 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444698
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.