Sequence 1: | NP_001287169.1 | Gene: | dpr16 / 40619 | FlyBaseID: | FBgn0037295 | Length: | 488 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001274153.1 | Gene: | Lrit3 / 242235 | MGIID: | 2685267 | Length: | 681 | Species: | Mus musculus |
Alignment Length: | 325 | Identity: | 65/325 - (20%) |
---|---|---|---|
Similarity: | 110/325 - (33%) | Gaps: | 117/325 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 221 KLNQHSGKPLSWVRLRD-EHIIAVDHTTFINDARFASL---------------LQSTTLTTLVSG 269
Fly 270 GALSTTATPVAALGNSFAH--AVPGGQERGNSSSLSWTLQIKYVNLEDAGWY-ECQLATEPKMS- 330
Fly 331 ---------------AKVQLF--VITPRTELIGDRQRFVK-------------AGSRVELHCIVR 365
Fly 366 GTLEAPKYIFWYRGDQQV---TAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIH 427
Fly 428 --SGNYTCEPENSAAAS---MQLHVLSGEYSA----SAIKSTAARPHR-----LGHGYTSLHQWL 478
Fly 479 478 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr16 | NP_001287169.1 | IG_like | 205..337 | CDD:214653 | 30/152 (20%) |
Ig | <298..338 | CDD:299845 | 8/58 (14%) | ||
IG_like | 352..447 | CDD:214653 | 23/115 (20%) | ||
Ig | 358..439 | CDD:143165 | 18/85 (21%) | ||
Lrit3 | NP_001274153.1 | LRR 1. /evidence=ECO:0000255 | 56..79 | ||
LRR_8 | 61..117 | CDD:290566 | 1/5 (20%) | ||
LRR 2. /evidence=ECO:0000255 | 80..103 | ||||
leucine-rich repeat | 83..106 | CDD:275378 | |||
LRR 3. /evidence=ECO:0000255 | 104..128 | 5/16 (31%) | |||
LRR_8 | 105..165 | CDD:290566 | 13/57 (23%) | ||
LRR_4 | 106..146 | CDD:289563 | 11/38 (29%) | ||
leucine-rich repeat | 107..130 | CDD:275378 | 6/18 (33%) | ||
LRR_4 | 129..170 | CDD:289563 | 11/55 (20%) | ||
LRR 4. /evidence=ECO:0000255 | 129..151 | 5/25 (20%) | |||
leucine-rich repeat | 131..154 | CDD:275378 | 4/26 (15%) | ||
LRR 5. /evidence=ECO:0000255 | 152..175 | 8/34 (24%) | |||
leucine-rich repeat | 155..168 | CDD:275378 | 4/12 (33%) | ||
Ig | 254..335 | CDD:299845 | 20/103 (19%) | ||
IG_like | 263..339 | CDD:214653 | 22/98 (22%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 350..391 | 7/36 (19%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 425..464 | ||||
FN3 | 489..563 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |