DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and Igsf9b

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:422 Identity:93/422 - (22%)
Similarity:123/422 - (29%) Gaps:154/422 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VLMLGDDQQQQEYDTTVVDSW----SDRPDTATLTKGFSIPSYLPPFPEFIPADLPHMLRNASSG 147
            ||||     .|:|||....||    .:.|.|.|.|.           |::|         .|..|
Mouse   117 VLML-----DQQYDTFHNGSWVHLTINAPPTFTETP-----------PQYI---------EAKEG 156

  Fly   148 AAPPADIGPSGSPMP--------SKPNEQSRLHAYDSEQKAQQLRREKELAKERELLPRRQLSL- 203
            .:........|:|.|        :.....::....|.......:.||     :|.....|..|: 
Mouse   157 GSITMTCTAFGNPKPIVTWLKEGTLLGASAKYQVSDGSLTVTSVSRE-----DRGAYTCRAYSIQ 216

  Fly   204 -------------------PPLNATVQAGQHAYLPCKLNQHSGK-PLSWVRLRDEHIIAVDHTTF 248
                               ||.|.||...|.|.|.|:...:.|. ..:|. .:||::.      |
Mouse   217 GEAVHTTHLLVQGPPFIVSPPENITVNISQDALLTCRAEAYPGNLTYTWY-WQDENVY------F 274

  Fly   249 INDARFASLLQSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNL 313
            .||.:.       .:..|:.|                                   ||.|..|..
Mouse   275 QNDLKL-------RVRILIDG-----------------------------------TLIIFRVKP 297

  Fly   314 EDAGWYEC----QLATEPKMSAKVQLFVITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYI 374
            ||||.|.|    .|...|  ||...|.|..|...|......:|..|....:.|.|  ..|.|..:
Mouse   298 EDAGKYTCVPSNSLGRSP--SASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPV--DAEPPATV 358

  Fly   375 F-WYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPEN- 437
            . |.:..:.:..|...     ||....|              ||:.|....:...|.|||.|.| 
Mouse   359 VKWNKDGRPLQVEKNL-----GWTLMED--------------GSIRIEEATEEALGTYTCVPYNT 404

  Fly   438 ------SAAASMQLH------VLSG-EYSASA 456
                  ||.|.:.|.      ||.| ||...|
Mouse   405 LGTMGQSAPARLVLKDPPYFTVLPGWEYRQEA 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 32/136 (24%)
Ig <298..338 CDD:299845 15/43 (35%)
IG_like 352..447 CDD:214653 24/108 (22%)
Ig 358..439 CDD:143165 18/88 (20%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273 93/422 (22%)
I-set 141..227 CDD:369462 16/110 (15%)
Ig 231..323 CDD:386229 33/142 (23%)
Ig <355..416 CDD:386229 18/79 (23%)
Ig 440..504 CDD:319273
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.