DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and zig-10

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001122644.1 Gene:zig-10 / 188896 WormBaseID:WBGene00020800 Length:322 Species:Caenorhabditis elegans


Alignment Length:275 Identity:59/275 - (21%)
Similarity:87/275 - (31%) Gaps:76/275 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 LLPRRQLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQ 259
            |.|::    .|....|..|....|.|:  .::...::|  .||:|:||.                
 Worm    25 LAPKK----APTERLVPIGSTTALECE--PYTSSNVTW--YRDKHVIAT---------------- 65

  Fly   260 STTLTTLVSG--GALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQ 322
                   |.|  .|:.....|            .||:||......   |.|..|..||.|.|.||
 Worm    66 -------VEGHKNAILNERKP------------RGGEERIPEIGF---LVIFDVQKEDEGNYYCQ 108

  Fly   323 LATEPKMSAKVQLFVI----TPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQV 383
            ...:.|.....||.:.    ..:.|.|.........|..:.|||.:......|| :.|......:
 Worm   109 RENDSKWGEVFQLKIAYVDEISQNEKIKLEPNVPTLGRSLVLHCPIPKAYPPPK-VTWTVNSLPI 172

  Fly   384 TAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAA-ASMQLHV 447
            :            :...|...|.:        |:|:|......|.|.:.|...|.|. ||....:
 Worm   173 S------------HISSDYVAFPN--------GTLIISHFSYHHFGYFECNINNFAGHASTNTFI 217

  Fly   448 LSGEYSAS--AIKST 460
            .|.|..|:  ::|.|
 Worm   218 DSRELVANLESLKPT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 31/133 (23%)
Ig <298..338 CDD:299845 12/39 (31%)
IG_like 352..447 CDD:214653 19/95 (20%)
Ig 358..439 CDD:143165 15/80 (19%)
zig-10NP_001122644.1 IG_like 31..118 CDD:214653 29/128 (23%)
IGc2 38..111 CDD:197706 26/114 (23%)
IG_like 143..215 CDD:214653 19/92 (21%)
IGc2 145..209 CDD:197706 16/84 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.