DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and zig-4

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:260 Identity:50/260 - (19%)
Similarity:90/260 - (34%) Gaps:64/260 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 HAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGG-----ALST 274
            :|:.|.....||    :.|.|.:|  |..::.|.....:..:.|:|    .|:.||     ....
 Worm    15 NAHPPMHAEMHS----AVVTLANE--IDTNYLTSPAKIKIVAPLES----ALIPGGETYQLRCDI 69

  Fly   275 TATPVAALGNSF-AHAVPGGQERG-------------NSSSLSWTLQIKYVNLEDAGWYECQLAT 325
            .:||.|.:...| ...:.|..|..             ::..::..|.|:..:.|::|.|.|    
 Worm    70 MSTPAATIHWKFNGKLIQGSNELNVEEKLLNFGKAIVDTGIVASILTIQCPSAENSGTYSC---- 130

  Fly   326 EPKMSAKVQLFVITPRTELIG-DRQRFVKAGSRVELHCIVRGT----LEAPKYIFWYRGDQQVTA 385
                               :| :..:.::..:.||:.....|.    ..||:.:||.....::|.
 Worm   131 -------------------VGYNGHQTIETVAEVEIEGEASGCRSNHKSAPEIVFWTDSRFEMTG 176

  Fly   386 ENEA-----SGAQSGW-YTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQ 444
             |.|     :..|..| :...|..:..:.:....:.|.|||..:.....|.|||...|....:.|
 Worm   177 -NVATLVCRANQQVDWVWMSNDELVKNNDKFTVLSNGDLVIKNIVWDDMGTYTCIARNQFGEARQ 240

  Fly   445  444
             Worm   241  240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 26/140 (19%)
Ig <298..338 CDD:299845 6/39 (15%)
IG_like 352..447 CDD:214653 23/103 (22%)
Ig 358..439 CDD:143165 22/90 (24%)
zig-4NP_509335.1 I-set 47..147 CDD:254352 19/126 (15%)
Ig 65..144 CDD:143165 13/101 (13%)
IG_like 176..245 CDD:214653 15/66 (23%)
Ig <193..238 CDD:299845 10/44 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.