Sequence 1: | NP_001287169.1 | Gene: | dpr16 / 40619 | FlyBaseID: | FBgn0037295 | Length: | 488 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001362087.1 | Gene: | igcm-2 / 180913 | WormBaseID: | WBGene00020130 | Length: | 802 | Species: | Caenorhabditis elegans |
Alignment Length: | 316 | Identity: | 66/316 - (20%) |
---|---|---|---|
Similarity: | 95/316 - (30%) | Gaps: | 122/316 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 211 QAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGALSTT 275
Fly 276 ATPVAALGNSFAHAVPGGQER-GNSSSLSWTLQIKYVNLEDAGWYEC------QLATEPKMSAKV 333
Fly 334 QLFVITPRTELIGDRQRFV--KAGSRVELHCIVRGTLEAPK-YIFWYRGDQQV------TAENEA 389
Fly 390 SGAQSGWYTQIDRNIFGSTEH-----------------NRNTI---------------------- 415
Fly 416 --------------------GSLVIPLVRKIHSGNYTCEPENSA----AASMQLHV 447 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr16 | NP_001287169.1 | IG_like | 205..337 | CDD:214653 | 26/132 (20%) |
Ig | <298..338 | CDD:299845 | 12/45 (27%) | ||
IG_like | 352..447 | CDD:214653 | 36/166 (22%) | ||
Ig | 358..439 | CDD:143165 | 31/146 (21%) | ||
igcm-2 | NP_001362087.1 | IG_like | 23..101 | CDD:214653 | 23/113 (20%) |
Ig | 124..200 | CDD:386229 | 19/79 (24%) | ||
IG_like | 214..298 | CDD:214653 | 17/83 (20%) | ||
Ig_3 | 309..371 | CDD:372822 | |||
Ig | 389..467 | CDD:386229 | |||
FN3 | 476..548 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |