DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and Ncam1

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:311 Identity:58/311 - (18%)
Similarity:98/311 - (31%) Gaps:98/311 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 LSLPP--------LNATVQAGQHAYLPCKLNQHSGKPLSWVR----LRDE------HIIAVDHT- 246
            :::||        :|||...||...|.|..:......:||.:    :.:|      ||.:.|.: 
Mouse   208 VNVPPTVQARQSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPIENEEEDDEKHIFSDDSSE 272

  Fly   247 ---------------------------------------TFINDARFASLLQSTTLTTLVSGGAL 272
                                                   |::.:.....|.:..|||...||..:
Mouse   273 LTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPI 337

  Fly   273 ST----TATPVAALGNSFAHAVPGGQE--------RGNSSSLSWTLQIKYVNLEDAGWYECQLAT 325
            .:    |:|...:.....:...|..||        |.::...|.||  |.:...|||.|.|..:.
Mouse   338 PSITWRTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLTL--KSIQYTDAGEYICTASN 400

  Fly   326 EPKMSAKVQLFVITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEAS 390
            .....::.....:....:|.|....:...|::|.:.|.|.....|.  |.|:|..|.:.:.|.::
Mouse   401 TIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSAT--ISWFRDGQLLPSSNYSN 463

  Fly   391 ----GAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPEN 437
                ...|..|.::       |..:.|..             |||.|...|
Mouse   464 IKIYNTPSASYLEV-------TPDSENDF-------------GNYNCTAVN 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 36/201 (18%)
Ig <298..338 CDD:299845 9/39 (23%)
IG_like 352..447 CDD:214653 19/90 (21%)
Ig 358..439 CDD:143165 18/84 (21%)
Ncam1XP_006510118.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652
Ig3_NCAM-1_like 211..308 CDD:143207 15/96 (16%)
Ig_NCAM-1 307..413 CDD:143277 22/107 (21%)
Ig_3 417..494 CDD:372822 20/98 (20%)
FN3 509..606 CDD:238020
fn3 649..731 CDD:365830
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.