DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and rig-5

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:140 Identity:39/140 - (27%)
Similarity:56/140 - (40%) Gaps:29/140 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 WTLQIKYVNLEDAGWYECQLATEP------KMSAKVQLFVITPRTELIGDRQRFVKAGSRVELHC 362
            |.|.||.|...|.|.|.||:.|||      ::..||.. |::..|....:    |:.|:.|.|.|
 Worm   154 WVLTIKNVQESDRGNYSCQINTEPITLSTGELDVKV
PP-VVSRSTPAAVE----VREGNNVSLTC 213

  Fly   363 IVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIH 427
            ...|. ..|. :.|.|.|:|:...|.|:|             ||::..:...   |.:..|.:.|
 Worm   214 KADGN-PTPT-VIWRRQDRQIIRYNGATG-------------FGASVFHGPV---LHLTKVSRKH 260

  Fly   428 SGNYTCEPEN 437
            ...|.|...|
 Worm   261 MSEYLCVASN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 15/38 (39%)
Ig <298..338 CDD:299845 15/39 (38%)
IG_like 352..447 CDD:214653 22/86 (26%)
Ig 358..439 CDD:143165 20/80 (25%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 13/34 (38%)
Ig_3 191..270 CDD:372822 23/101 (23%)
IG 294..380 CDD:214652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.