DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and nitr1d

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_938163.1 Gene:nitr1d / 170990 ZFINID:ZDB-GENE-020225-11 Length:324 Species:Danio rerio


Alignment Length:204 Identity:49/204 - (24%)
Similarity:80/204 - (39%) Gaps:39/204 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 NSSSLSWTLQIKYVNLEDAGWYECQLAT--EPKMSAKVQLFVITPRTELIGDR-----QRFVKA- 354
            |.....:.|.|......|:..|.|.:::  ...|.:..:|.|   |.| ..||     |..:.| 
Zfish    88 NKGDFYFNLTIVKTKPSDSATYYCVVSSYQATGMGSGTRLLV---R
DE-AADRNTTLHQSLIDAV 148

  Fly   355 --GSRVELHC-IVRGTLEAPKYIFWYRGDQQVTAENEASGAQSG-WYTQIDRN--IFGSTE-HNR 412
              |..|.|.| |...:......::|::         ::||...| .||:.:||  ...||| ..:
Zfish   149 DPGDSVHLQCSIFTESCAGDHRVYWFK---------QSSGDSEGVLYTKGERNGRCKNSTESQTQ 204

  Fly   413 NTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAIKSTA-ARPHRLGHGYTSLHQ 476
            :.:.||....:.:..||.|.|    :.||..:  :|.|..:...||... ..|..|..|.|:   
Zfish   205 SCVYSLHKNNISRSDSGIYYC----AVAACGE--ILLGRGTQLNIKERCDFNPALLASGITN--- 260

  Fly   477 WLIFLLVAL 485
             ::||.:.:
Zfish   261 -IVFLALVV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 8/40 (20%)
Ig <298..338 CDD:299845 8/41 (20%)
IG_like 352..447 CDD:214653 25/102 (25%)
Ig 358..439 CDD:143165 21/85 (25%)
nitr1dNP_938163.1 Ig 35..130 CDD:299845 9/44 (20%)
IG_like 59..129 CDD:214653 8/40 (20%)
IG_like 148..227 CDD:214653 22/91 (24%)
V-set 150..243 CDD:284989 26/107 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.