DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and nitr1l

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_938161.2 Gene:nitr1l / 170986 ZFINID:ZDB-GENE-020225-7 Length:316 Species:Danio rerio


Alignment Length:199 Identity:48/199 - (24%)
Similarity:75/199 - (37%) Gaps:49/199 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 YVNL-------EDAGWYECQLATEPKMSAKVQLFVITPRTELI---GDRQR--------FVKAGS 356
            |.||       .|:..|.|.::|       ...|.:...|.|:   .||..        .|..|.
Zfish    91 YFNLTILKTKPSDSATYYCVIST-------FYTFGMGSGTRLLVR
AADRNTTLHQSLIDTVDPGD 148

  Fly   357 RVELHC-IVRGTLEAPKYIFWYRGDQQVTAENEASGAQSG-WYTQIDRN--IFGSTE-HNRNTIG 416
            .|.|.| |...:.|....|:|::         ::||...| .||:.:||  ...||| ..::.:.
Zfish   149 SVNLQCSIFTESCEGDHSIYWFK---------QSSGDSEGVLYTKGERNGRCKDSTESQTQSCVY 204

  Fly   417 SLVIPLVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAIKSTAARPHRLGHGYTSLHQWLIFL 481
            ||....:.:..||.|.|      |.:....:|.|..:...|:.:...|..|..|.|:    :|||
Zfish   205 SLHKNNISRSDSGIYYC------AVATCGQILIGRGTQLNIRESDFNPALLASGITN----VIFL 259

  Fly   482 LVAL 485
            .:.:
Zfish   260 ALVV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 7/33 (21%)
Ig <298..338 CDD:299845 8/34 (24%)
IG_like 352..447 CDD:214653 26/99 (26%)
Ig 358..439 CDD:143165 23/85 (27%)
nitr1lNP_938161.2 V-set 30..128 CDD:311561 10/43 (23%)
V-set 143..240 CDD:311561 28/111 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.