Sequence 1: | NP_001287169.1 | Gene: | dpr16 / 40619 | FlyBaseID: | FBgn0037295 | Length: | 488 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_938161.2 | Gene: | nitr1l / 170986 | ZFINID: | ZDB-GENE-020225-7 | Length: | 316 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 48/199 - (24%) |
---|---|---|---|
Similarity: | 75/199 - (37%) | Gaps: | 49/199 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 310 YVNL-------EDAGWYECQLATEPKMSAKVQLFVITPRTELI---GDRQR--------FVKAGS 356
Fly 357 RVELHC-IVRGTLEAPKYIFWYRGDQQVTAENEASGAQSG-WYTQIDRN--IFGSTE-HNRNTIG 416
Fly 417 SLVIPLVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAIKSTAARPHRLGHGYTSLHQWLIFL 481
Fly 482 LVAL 485 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr16 | NP_001287169.1 | IG_like | 205..337 | CDD:214653 | 7/33 (21%) |
Ig | <298..338 | CDD:299845 | 8/34 (24%) | ||
IG_like | 352..447 | CDD:214653 | 26/99 (26%) | ||
Ig | 358..439 | CDD:143165 | 23/85 (27%) | ||
nitr1l | NP_938161.2 | V-set | 30..128 | CDD:311561 | 10/43 (23%) |
V-set | 143..240 | CDD:311561 | 28/111 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1457433at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |