DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and nitr1m

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_021333060.1 Gene:nitr1m / 170971 ZFINID:ZDB-GENE-020225-5 Length:326 Species:Danio rerio


Alignment Length:305 Identity:66/305 - (21%)
Similarity:101/305 - (33%) Gaps:100/305 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 AGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTT--LTTLVSGGALST 274
            ||:...|||                                .|:.|||:|.  ......|.:|..
Zfish    31 AGEDVNLPC--------------------------------TFSRLLQATKAWFKQTADGKSLQI 63

  Fly   275 TATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIK--YVNL-------EDAGWYECQLATEPK-- 328
            .:.        :...:|..   .|:|...:.:..:  |.||       .|:..|.|.::|...  
Zfish    64 VSL--------YLDQIPNW---NNNSENGFNIMKEDGYFNLTILKTKPSDSATYYCVISTAYNIG 117

  Fly   329 MSAKVQLFV--------ITPRTELIGDRQRFVKAGSRVELHC-IVRGTLEAPKYIFWYRGDQQVT 384
            |.:..:|||        .|....||..    |..|..|.|.| |...:......::|::      
Zfish   118 MGSGTRLFVR
DSAKDRNTTLHQSLIDT----VDPGDSVNLQCSIFTESCAGDHSVYWFK------ 172

  Fly   385 AENEASGAQSG-WYTQIDRN--IFGSTE-HNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQL 445
               ::||...| .||:.:||  ...||| ..::.:.||....:.:..||.|.|     |.||.. 
Zfish   173 ---QSSGDSEGVLYTKGERNGRCKDSTESQTQSCVYSLHKNNISRSDSGIYYC-----AVASCG- 228

  Fly   446 HVLSGEYSASAIKSTAARPHRLGHGYTSLHQW-----LIFLLVAL 485
            .:|.|       :.|.......||.|..|...     :|||.:|:
Zfish   229 EILLG-------RGTQLNIRESGHLYPGLLALFGVLNIIFLALAV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 24/137 (18%)
Ig <298..338 CDD:299845 13/58 (22%)
IG_like 352..447 CDD:214653 26/99 (26%)
Ig 358..439 CDD:143165 21/85 (25%)
nitr1mXP_021333060.1 V-set 29..127 CDD:311561 25/138 (18%)
V-set 144..241 CDD:311561 29/122 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.