DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and Dscam

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_006522949.1 Gene:Dscam / 13508 MGIID:1196281 Length:2034 Species:Mus musculus


Alignment Length:370 Identity:86/370 - (23%)
Similarity:125/370 - (33%) Gaps:110/370 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 FIPADLPHMLRNASSGAAPPADIGPSGSPMPSKPNEQSRLHAYDSEQKAQQLRREKELAKERELL 196
            |:.|.|..::..::||...|.       |....|....|.:....|:       ..::...|.:.
Mouse    26 FVNASLQEVVFASTSGTLVPC-------PAAGIPPVTLRWYLATGEE-------IYDVPGIRHVH 76

  Fly   197 PRRQLSL---PPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAV---DHTTFIND---- 251
            |...|.:   ||.:.:.....:.|. |.....|||    :|.:|.||.||   .:|..:.|    
Mouse    77 PNGTLQIFPFPPSSFSTLIHDNTYY-CTAENPSGK----IRSQDVHIKAVLREPYTVRVEDQKTM 136

  Fly   252 ----ARFASLLQSTT------------LTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSS 300
                |.|..::.|:.            ..:||||.....|:|                       
Mouse   137 RGNVAVFKCIIPSSVEAYVTVVSWEKDTVSLVSGSRFLITST----------------------- 178

  Fly   301 SLSWTLQIKYVNLEDAGW-YEC----QLATEPKMSAKVQLFVITPRTE----LIGDRQRFVKAGS 356
               ..|.||.|..||..: |.|    :...|.:.|...:|||..|...    |.|...|...||.
Mouse   179 ---GALYIKDVQNEDGLYNYRCITRHRYTGETRQSNSARLFVSDPANSAPSILDGFDHRKAMAGQ 240

  Fly   357 RVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIP 421
            ||||.|...|..| |.| .|.:.:..:    |.||                  ..:.|:..|:|.
Mouse   241 RVELPCKALGHPE-PDY-RWLKDNMPL----ELSG------------------RFQKTVTGLLIE 281

  Fly   422 LVRKIHSGNYTCEPEN---SAAASMQLHV---LSGEYSASAIKST 460
            ..|...||:|.||..|   :|....:|:|   |....|...:||:
Mouse   282 NSRPSDSGSYVCEVSNRYGTAKVIGRLYVKQPLKATISPRKVKSS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 34/159 (21%)
Ig <298..338 CDD:299845 12/44 (27%)
IG_like 352..447 CDD:214653 27/97 (28%)
Ig 358..439 CDD:143165 22/83 (27%)
DscamXP_006522949.1 Ig 15..115 CDD:386229 21/107 (20%)
IGc2 239..300 CDD:197706 24/84 (29%)
IG 320..400 CDD:214652 2/7 (29%)
Ig_3 410..488 CDD:372822
IGc2 518..575 CDD:197706
Ig 596..686 CDD:386229
Ig_DSCAM 707..784 CDD:143211
Ig 802..889 CDD:386229
FN3 885..978 CDD:238020
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig_3 1301..1363 CDD:372822
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.