DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and LOC100909964

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_008767726.1 Gene:LOC100909964 / 100909964 RGDID:6500592 Length:308 Species:Rattus norvegicus


Alignment Length:242 Identity:55/242 - (22%)
Similarity:93/242 - (38%) Gaps:56/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 DARFASLLQSTTLTTLVSGGAL-----STTATPVAAL-----------------GNSFAHA--VP 291
            |.:...::|...|.::..||::     .|:.|||...                 |:.|...  :.
  Rat    27 DMKELKVIQPQKLVSVYDGGSVILNCTVTSLTPVGPTRWFKGEGQNRQLIYSFRGDYFPRITNIA 91

  Fly   292 GGQERGNSSSLSWTLQIKYVNLEDAGWYEC---QLAT-EPKMSAK----VQLFV---------IT 339
            ...:|.|:   .::::|..:.|.|||.|.|   |..| ||.:..:    .:|||         :.
  Rat    92 DVTKRNNT---DFSIRISNIMLADAGTYYCVKFQKGTVEPDIEIQSGGGTELFVYGADMKKLKVV 153

  Fly   340 PRTELIGDRQRFVKAGSRVELHCIVRGTLE-APKYIFWYRGDQQVTAENEASGAQSGWYTQIDRN 403
            ...:||.     |.||..|.|:|.|...:. .|  |.|:||.|.  :.:.......|::.:: .|
  Rat   154 QPEKLIS-----VDAGESVTLNCTVTSIIPMGP--IKWFRGAQH--SRHLIFNFTGGYFPRV-TN 208

  Fly   404 IFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHVLSG 450
            :..|::.| |...|:.|..|....:|.|.|...........:.:.||
  Rat   209 VSDSSKRN-NLDFSIRISNVMPADAGTYYCVKFQKELLETDIEIQSG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 25/117 (21%)
Ig <298..338 CDD:299845 15/56 (27%)
IG_like 352..447 CDD:214653 24/95 (25%)
Ig 358..439 CDD:143165 21/81 (26%)
LOC100909964XP_008767726.1 V-set 35..142 CDD:284989 24/109 (22%)
IG_like 40..142 CDD:214653 22/104 (21%)
V-set 154..261 CDD:284989 28/112 (25%)
IG_like 159..238 CDD:214653 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.