DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and iglon5

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:333 Identity:67/333 - (20%)
Similarity:103/333 - (30%) Gaps:113/333 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 PLSWVRLRDEHIIAVDHTTFINDARF--------ASLLQSTTLTTLVSGGALSTTATPVAALGNS 285
            ||..|.|....|:.:....|:....|        .|...:.||:.|:     ....|.||.|..|
 Frog     4 PLQRVSLASLGIVMLAQVLFVQCTEFVPPADNYTVSQGDNATLSCLI-----DDKVTRVAWLNRS 63

  Fly   286 FAHAVPGGQERGN---------SSSLSWTLQIKYVNLEDAGWYECQLATEPK-MSAKVQLFVITP 340
              :.:..|:::.:         ::...:::.|.:|::.|.|.|.|...||.| .:::|.|.|..|
 Frog    64 --NILYAGKDKWSIDSRVQLLTNTKSEYSIVITHVDVADEGLYTCSFQTEDKPHTSQVYLIVQVP 126

  Fly   341 RTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYR----------------------GDQQV 383
            ...:.......|..||.|.|.|:..|..|..  |.|.:                      ||.:.
 Frog   127 AKIVNISSSVTVNEGSNVNLQCLAVGKPEPT--ITWQQLSEGFSSEGELLEITEINRQQAGDYEC 189

  Fly   384 TAEN---------------------EASGAQS--------------------GWYTQIDRNIFGS 407
            ...|                     :...|||                    .||....|.:...
 Frog   190 VTSNGVSVPDTKKVQITVNYPPYITDVKNAQSPVGRPATLRCKAMAVPPAEFEWYKDEKRRLISG 254

  Fly   408 TE----HNRNTIGSLVIPLVRKIHSGNYTC-------------------EPENSAAASMQLHVLS 449
            ||    ...::...:|...|...|.|||||                   :|.|..|..|...:|.
 Frog   255 TEGLSIKTESSWSVIVFSNVTSRHYGNYTCLASNKLGSFNSSLRLLKPGDPLNQGATHMVSPLLL 319

  Fly   450 GEYSASAI 457
            |..|::.|
 Frog   320 GLLSSTLI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 28/125 (22%)
Ig <298..338 CDD:299845 11/49 (22%)
IG_like 352..447 CDD:214653 33/180 (18%)
Ig 358..439 CDD:143165 28/166 (17%)
iglon5XP_002938252.1 Ig 31..123 CDD:299845 21/98 (21%)
IG_like 35..123 CDD:214653 21/94 (22%)
Ig 126..207 CDD:299845 14/82 (17%)
I-set 128..207 CDD:254352 13/80 (16%)
I-set 210..299 CDD:254352 16/88 (18%)
Ig 227..298 CDD:143165 13/70 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.