DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and Kirrel2

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_038957463.1 Gene:Kirrel2 / 100359836 RGDID:1308456 Length:711 Species:Rattus norvegicus


Alignment Length:287 Identity:66/287 - (22%)
Similarity:94/287 - (32%) Gaps:88/287 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 PLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSG 269
            |.:..|..||.|.|||.|..:.|. :.|                             |...|..|
  Rat    38 PEDMVVLLGQEARLPCALGAYRGL-VQW-----------------------------TKDGLALG 72

  Fly   270 GALSTTATPVAALGNSFAHAVPGGQE---RGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSA 331
            |                ...:||...   .|||:|....|.||.|.|||...||||.:.....|.
  Rat    73 G----------------ERDLPGWSRYWISGNSASGQHDLHIKPVELEDEASYECQASQAGLRSR 121

  Fly   332 KVQLFVITP--RTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGD--------QQVTAE 386
            ..||.|:.|  ..:::|.....:.||....|.|..||.......:.|:|..        .|:|..
  Rat   122 PAQLHVMVPPEAPQVLGGPSVSLVAGVPGNLTCRSRGDARPAPELLWFRDGIRLDGTSFHQITLR 186

  Fly   387 NEASG-----------AQSGWYTQIDRNIFGSTEHNRNTIGSLVI---PLVRKIHSGNYTCEPEN 437
            ::|:|           :|....|.|.|....:....|:|..:|.:   |:|      ..:.||:.
  Rat   187 DKATGTVENTLFLTPSSQDDGATLICRARSQALPTGRDTAVTLSLQYPPMV------TLSAEPQT 245

  Fly   438 SAAASMQLHVLSGEYSASAIKSTAARP 464
            :.         .||......::||..|
  Rat   246 AQ---------EGEKVTFLCQATAQPP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 35/134 (26%)
Ig <298..338 CDD:299845 17/39 (44%)
IG_like 352..447 CDD:214653 23/116 (20%)
Ig 358..439 CDD:143165 21/102 (21%)
Kirrel2XP_038957463.1 IG_like 38..127 CDD:214653 35/134 (26%)
Ig strand A' 40..44 CDD:409353 0/3 (0%)
Ig strand B 48..57 CDD:409353 5/8 (63%)
Ig strand C 62..66 CDD:409353 1/32 (3%)
Ig strand D 75..85 CDD:409353 2/9 (22%)
Ig strand E 88..100 CDD:409353 5/11 (45%)
Ig strand F 107..115 CDD:409353 4/7 (57%)
Ig strand G 117..127 CDD:409353 3/9 (33%)
Ig 133..231 CDD:416386 20/97 (21%)
Ig strand A 134..137 CDD:409353 0/2 (0%)
Ig strand A' 140..144 CDD:409353 0/3 (0%)
Ig strand B 151..158 CDD:409353 2/6 (33%)
Ig strand C 164..169 CDD:409353 0/4 (0%)
Ig strand C' 172..174 CDD:409353 0/1 (0%)
Ig strand D 177..184 CDD:409353 1/6 (17%)
Ig strand E 191..199 CDD:409353 1/7 (14%)
Ig strand F 208..216 CDD:409353 3/7 (43%)
Ig strand G 222..228 CDD:409353 2/5 (40%)
Ig_3 234..303 CDD:404760 9/45 (20%)
Ig strand B 252..256 CDD:409353 0/3 (0%)
Ig strand C 266..270 CDD:409353
Ig strand E 283..286 CDD:409353
Ig strand F 292..301 CDD:409353
Ig strand G 309..312 CDD:409353
Ig 326..403 CDD:416386
Ig strand A' 327..332 CDD:409353
Ig strand B 335..344 CDD:409353
Ig strand C 350..354 CDD:409353
Ig strand C' 357..359 CDD:409353
Ig strand D 362..365 CDD:409353
Ig strand E 366..371 CDD:409353
Ig strand F 379..387 CDD:409353
Ig strand G 393..403 CDD:409353
Ig 405..509 CDD:416386
Ig strand A 406..410 CDD:409353
Ig strand A' 412..415 CDD:409353
Ig strand B 423..430 CDD:409353
Ig strand C 437..442 CDD:409353
Ig strand C' 444..447 CDD:409353
Ig strand D 455..462 CDD:409353
Ig strand E 472..479 CDD:409353
Ig strand F 490..497 CDD:409353
Ig strand G 500..507 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.