DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and nitr5

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001135740.1 Gene:nitr5 / 100216319 ZFINID:ZDB-GENE-020225-40 Length:337 Species:Danio rerio


Alignment Length:153 Identity:36/153 - (23%)
Similarity:51/153 - (33%) Gaps:46/153 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 GSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQS-------GWYTQIDRNIFGSTEHNR 412
            |....|.|.:  |........||:   |||.|.....|.|       .::.:.|.:.|   |..|
Zfish    35 GETAVLRCFI--TNSQMSMTLWYK---QVTGEEPRLIASSILRSSEIQFHNEFDSSHF---EVLR 91

  Fly   413 NTIGSLVIPLVRKIH--SGNYTCEPENSAAAS-------------------MQLHVLSGEYSAS- 455
            :| |...:.:|..:.  ||.|.|....|....                   :|||.|....||. 
Zfish    92 DT-GGFNLKIVNAVQSDSGTYYCATSFSNVIEFGNGTRLVVKGTNLNKPTYLQLHELEQVESAKN 155

  Fly   456 ----AIKSTAAR-PHRL---GHG 470
                ::::...| .|||   .||
Zfish   156 PLLCSVQNQLVRNEHRLYWFSHG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653
Ig <298..338 CDD:299845
IG_like 352..447 CDD:214653 26/119 (22%)
Ig 358..439 CDD:143165 22/89 (25%)
nitr5NP_001135740.1 Ig 23..132 CDD:299845 24/105 (23%)
IG_like 29..131 CDD:214653 24/104 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.