DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and kirrel1b

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b / 100170816 ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio


Alignment Length:190 Identity:49/190 - (25%)
Similarity:72/190 - (37%) Gaps:50/190 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 WTLQIKYVNLEDAGWYECQLATEPKM-SAKVQLFVITPRTELI--GDRQRFVKAGSRVELHCIVR 365
            :.|:|...:|.|...|||| |||..: |.:.:|.|:.|....:  |..:..:.||:...|.|:.|
Zfish    87 YNLEITSADLTDDSLYECQ-ATEAALRSRRAKLTVLIPPDGPVIEGSPEILLTAGTSFNLTCVSR 150

  Fly   366 G-----TLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRK 425
            |     |:|      ||:....|      .||.:......||        .|.|..|.:......
Zfish   151 GAKPMSTIE------WYKDGIIV------EGAHTSTEVLSDR--------KRVTTKSFLEIQPMD 195

  Fly   426 IHSG-NYTCEPENSAA-------ASMQLH-------------VLSGEYSASAIKSTAARP 464
            ..:| |:||...|.||       .::.:|             ||.||......::||..|
Zfish   196 TDTGRNFTCVASNLAAPLGKRSTVTLNIHHPPTVILSIEPRSVLEGERVKFTCQATANPP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 13/33 (39%)
Ig <298..338 CDD:299845 13/34 (38%)
IG_like 352..447 CDD:214653 26/120 (22%)
Ig 358..439 CDD:143165 21/86 (24%)
kirrel1bXP_017212964.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.