DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and lrit3b

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_009305418.1 Gene:lrit3b / 100144406 ZFINID:ZDB-GENE-070424-130 Length:487 Species:Danio rerio


Alignment Length:422 Identity:88/422 - (20%)
Similarity:139/422 - (32%) Gaps:148/422 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 TTVVDSWSDRPDTATLTKGFSIPSYLPPFPEFIPADLPH------MLRNASS----GAAPPADIG 155
            |.|:...||       |||........|....||.|||:      :.|.:.|    ||.      
Zfish    57 TCVLQGRSD-------TKGLRTVLCKNPALTAIPIDLPNDTVKFRLERTSVSRIFRGAF------ 108

  Fly   156 PSGSPMPS------KPNEQSRLH--AYDSEQKAQQLRREKELAKERELLPRRQLSLPPLNATVQA 212
               |.||.      ..|..|.||  ::.:.....:||.:..|           ||..|       
Zfish   109 ---SAMPELLYLWLTYNSISVLHPRSFTNLSSLHELRLDGNL-----------LSTFP------- 152

  Fly   213 GQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASL-------LQSTTLTTLVSGG 270
                               |..|||...:   .|..:::.|.|.:       |::.|...| |..
Zfish   153 -------------------WEGLRDMPRL---RTLGLHNNRLARIPLLAVRYLRNVTYLDL-SSN 194

  Fly   271 ALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWY-ECQLAT--------- 325
            .|||.|..:.||. .|:.:        |.:..|:.|     .|:|..|. :|:|:|         
Zfish   195 RLSTLANDLTALW-LFSDS--------NQTQRSFVL-----GLQDNPWVCDCRLSTLLDISRGPE 245

  Fly   326 -------------EP-----------KMSAKVQLFVITPRTELIGDRQRFVKAGSRVELHCIVRG 366
                         ||           ::|...:.:|:|..|::.      ...||.|.|.|...|
Zfish   246 SSLVLLDRFLTCSEPLDLAGVPFQSVELSRCRRPYVVTSATKIT------ALLGSTVLLRCEATG 304

  Fly   367 TLEAPKYIFWYR-GDQQVTAENEASGAQSGWYTQ-IDRNIFGSTEHN-RNTIGSLVIPL--VRKI 426
              .....:.|.: ..:.:..:......||...|: ..:.:||..:.: |..:...|:.|  :...
Zfish   305 --HPTPALMWIKSAKRNLYNQGCCKQTQSSLDTERFPKKLFGYVQESPRVGVRWSVVSLNGISYS 367

  Fly   427 HSGNYTCEPENSAAAS---MQLHVLS--GEYS 453
            .:|.|.|..:|.|..|   :.|:|:.  .||:
Zfish   368 DAGEYRCRAQNMAGISEAVVSLNVVGVMAEYT 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 31/172 (18%)
Ig <298..338 CDD:299845 12/73 (16%)
IG_like 352..447 CDD:214653 22/102 (22%)
Ig 358..439 CDD:143165 17/85 (20%)
lrit3bXP_009305418.1 LRRNT 51..92 CDD:214470 13/41 (32%)
leucine-rich repeat 69..89 CDD:275380 6/19 (32%)
LRR_8 112..172 CDD:290566 16/99 (16%)
leucine-rich repeat 114..137 CDD:275378 4/22 (18%)
leucine-rich repeat 138..161 CDD:275378 10/59 (17%)
LRR_8 160..214 CDD:290566 14/66 (21%)
LRR_4 160..201 CDD:289563 10/44 (23%)
leucine-rich repeat 162..185 CDD:275378 4/25 (16%)
leucine-rich repeat 186..199 CDD:275378 5/13 (38%)
leucine-rich repeat 215..230 CDD:275378 5/19 (26%)
Ig 278..391 CDD:299845 25/120 (21%)
I-set 279..391 CDD:254352 25/119 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.