DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1124 and CG14259

DIOPT Version :9

Sequence 1:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster


Alignment Length:267 Identity:60/267 - (22%)
Similarity:120/267 - (44%) Gaps:40/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VCLVIVIQALRMVQA-----ETPPYIKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDI--QLPSV 62
            :||..:.....:|.|     |.|.::..|...:|....|...:|:.|...|..|||::  :....
  Fly    21 LCLNEIAMDRSLVSAVAYYSEKPAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEVLERFGPF 85

  Fly    63 EP-------FKMD-----TLALQLTEGPQGYKITLKNMEAFGASNFKVTSLKLSEGSEPFKAKIV 115
            :|       ||.|     |:...||:      :.:|     |.:|.||...::|:....::.||.
  Fly    86 DPMRVRDIVFKQDNNEVATIRANLTD------LVVK-----GFANTKVKESRVSKKDFSWQTKIY 139

  Fly   116 MPKLKIEAKYTSSGVLLILPASGGGDFHANFEGVSADLTGKTSIHAFKGANYLHIDALSLVLDVK 180
            :||::::.:|..:|.:|::|.||.|......:.:...|..|..::...|..:.::.|:.:.|::.
  Fly   140 LPKMRLDGRYEMAGRILLIPLSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQLNLS 204

  Fly   181 DVKMSISGAFNNNRILLE-ATNLFLREN--------SQVVLEAMQAQLQKKLASEFGKL-ANQLL 235
            .|:..:...||.....:| :||.|..||        ..:::|.::..|...:::.|..: ||..:
  Fly   205 KVRTYLDNLFNGRSKEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIPANFFV 269

  Fly   236 KNVPVEQ 242
            :::|..|
  Fly   270 EDIPTPQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1124NP_649509.1 JHBP 6..244 CDD:284096 60/266 (23%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 56/247 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470474
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.