DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1124 and CG17279

DIOPT Version :9

Sequence 1:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_650937.3 Gene:CG17279 / 42489 FlyBaseID:FBgn0038850 Length:245 Species:Drosophila melanogaster


Alignment Length:258 Identity:57/258 - (22%)
Similarity:101/258 - (39%) Gaps:33/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVIVIQALRMVQA--ETPPYIKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQLPSVEPFKMDT 69
            |::.:..|.|..:  :.||.|::|...|...:...:..|..|.|   .|:|.|.|.:::....:.
  Fly     3 LIVFVCCLWMAPSLGQLPPEIEKCRAGDSICIAETVTRILRLYP---KGLPSIGLVALDSIGFED 64

  Fly    70 LALQLTE--GPQGYKITLKNMEAFGASNFKVTSLKLSEGSEPFKAKIV--MPKLKIEAKYTSSGV 130
            :.:...|  |...:.:...|:...|.::..||..|..:...|...::.  :|.||:...|...|.
  Fly    65 VVVSRLEPDGSSTFDLKFPNLTVIGFADSTVTEAKGFDADLPRVLELSGWIPLLKLNGTYEMRGS 129

  Fly   131 LLILPASGGGDFHANFE--------GVSADLTGKTSIHAFKGANYLHIDALSLVLDVKDVKMSIS 187
            ||.:|..|.|.......        .|..||..       .|..|..|..:..:|||:.:.:::.
  Fly   130 LLTMPIHGKGQAKVEIRECRVRCKVRVLEDLRD-------DGKLYAGISKVKCLLDVQGMHLNLE 187

  Fly   188 GAFNNNRILLEATNLFLRENSQVVLEAMQAQLQKKLASEFGKLANQLLKNV----PVEQFYVD 246
            ..|||.. :.:|.|:.....   .||... .|::.:.|...:|...:|:.|    |.:..|.|
  Fly   188 NLFNNPE-MSDAMNVVANTK---WLEIWH-NLRRGITSAVDQLVESILQRVANKLPYDDLYRD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1124NP_649509.1 JHBP 6..244 CDD:284096 55/254 (22%)
CG17279NP_650937.3 JHBP 5..243 CDD:336447 54/252 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.