DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1124 and CG7079

DIOPT Version :9

Sequence 1:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001287436.1 Gene:CG7079 / 42488 FlyBaseID:FBgn0038849 Length:255 Species:Drosophila melanogaster


Alignment Length:255 Identity:57/255 - (22%)
Similarity:100/255 - (39%) Gaps:28/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVIVIQALRMVQAE-TPPYIKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQLPSVEPFKM--- 67
            ::|.||....:|.: .|..:|:||..|.|   |.:.:...|......|||::.|   :||.:   
  Fly     7 VIITIQLFGGLQCQKLPAKVKKCHFGDGK---CLVESANALLRDFPKGIPEVDL---KPFNVLSV 65

  Fly    68 -DTLALQLTE-GPQGYKITLKNMEAFGASNFKVTSLKLSEGSEPFKAKI----VMPKLKIEAKYT 126
             |.|.:..:: |...|...|.|...:|..|..:|.:: ....:|...||    .:|:|..:..|.
  Fly    66 RDWLLVNDSQVGGAWYYFNLINQINYGFENTTITEIR-GFDKDPTTTKIEIHGKIPRLVYKGDYV 129

  Fly   127 SSG-VLLILPASGGGDFHANFEGVSADLTGKTSIHAFKGANYLHIDALSLVLDVKDVK-----MS 185
            :.| :|..:.....|...::|......||.|..:.......||.|..|     |.:::     |.
  Fly   130 AKGRMLWFVDIHSQGTSESDFLNFQFVLTLKVRVEYRNNKRYLKIYEL-----VPNIRLDRWIMW 189

  Fly   186 ISGAFNNNRILLEATNLFLRENSQVVLEAMQAQLQKKLASEFGKLANQLLKNVPVEQFYV 245
            :...|.:|..|..|.|.....|.......::..:.:...:.|..|...|.:.||.:..::
  Fly   190 LDNFFPDNEDLTIAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFEDLFEKVPYDDLFL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1124NP_649509.1 JHBP 6..244 CDD:284096 57/252 (23%)
CG7079NP_001287436.1 JHBP 20..249 CDD:214779 53/240 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470479
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.