DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1124 and CG14457

DIOPT Version :9

Sequence 1:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster


Alignment Length:239 Identity:59/239 - (24%)
Similarity:119/239 - (49%) Gaps:16/239 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ETPPYIKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDI-QLPSVEPFKMDTLALQLTEGPQ---G 80
            |.|.|||:|...|...|:|...:|:.|...|.:|||.: .:.|.:||.::  .:::|:|..   .
  Fly    27 EPPDYIKECRIADKDFVNCSTHSIQQLFDKLNDGIPGLTSIRSFDPFYLN--RIRITQGNSNAIN 89

  Fly    81 YKITLKNMEAFGASNFKVTSLKLSEGSEPFKAKIVMPKLKIEAKYTSSGVLLILPASGGGDFHAN 145
            .|:.|.|::..|..:..|...::.:....:|....:|::|::|.|:..|.:|::|.:|.|....:
  Fly    90 LKVELANVKIIGFGHTNVLDSQVFKKDYSWKTTFTLPEMKLQADYSLFGRILLIPLNGKGQVFLD 154

  Fly   146 FEGVSADLTGKTSIHAFKGANYLHIDALSLVLDVKDVKMSISGAFNNNRILLEATNLFLRENSQV 210
            .|.::..:..||.:::..|..:.::..|.:...:..:|...|..||.|:.|.::||.|..:|.::
  Fly   155 AENMTVTMHTKTRLYSKGGFTFYNVTNLHVDFKMDGLKSYFSNLFNGNKQLEDSTNKFFNDNWRM 219

  Fly   211 VLEAMQA----QLQKKLASEFGKL-----ANQLLKNVPV-EQFY 244
            :.:|:..    .::..|.....|:     ||..:.::|. ||.|
  Fly   220 LADALYTVITQTIEDILLDVLKKIFHFIPANFFVSDIPTPEQLY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1124NP_649509.1 JHBP 6..244 CDD:284096 58/237 (24%)
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 55/227 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.