DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1124 and CG33680

DIOPT Version :9

Sequence 1:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster


Alignment Length:242 Identity:52/242 - (21%)
Similarity:108/242 - (44%) Gaps:32/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CLVIVIQALRMVQAETPPY-IKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQLPS--VEPFKM 67
            |:::|...|..:......: |..|.||:|.|..|.|.|...::|.|.:|......|:  :||..:
  Fly    15 CVIVVFNFLFPINIFLLAFTITPCARNEPLLERCIINAAYQIRPLLVHGNLGDGFPTSPLEPLSL 79

  Fly    68 DTLALQLTEGPQGYKITLKNMEAFGASNFKVTSLKLSEGSEPFKAKIVMPKLKIEAKYTSSGVLL 132
            |.:.|:|:   ..::...|::||.|.:.....||.|:         :::|.:|            
  Fly    80 DNIELKLS---SQFQAVFKDLEANGGNYTGKYSLHLN---------LLLPDIK------------ 120

  Fly   133 ILPASGGGDFHANFEGVSADLTGKTSIHAFKGANYLHIDALSLVLDVKDVKMSISGAFNNNRILL 197
                 |.|:.....|...|.:..:.|.:...|.:|:....::.::|.||.|:.::..|:.:|.|.
  Fly   121 -----GKGNMQGYCENAKAFVKIRGSRYLRNGKDYVKFSKMTTLIDFKDFKLKLANLFSGDRFLG 180

  Fly   198 EATNLFLRENSQVVLEAMQAQLQKKLASEFGKLANQLLKNVPVEQFY 244
            :..|..:..|.::.|:.:...|:..|:..|..:|:::|.:...::.:
  Fly   181 DVGNSLINNNQELYLKDIAPSLEHGLSKHFLDVADKILASATFDEMF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1124NP_649509.1 JHBP 6..244 CDD:284096 52/240 (22%)
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 49/226 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.