DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1124 and CG16820

DIOPT Version :9

Sequence 1:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster


Alignment Length:232 Identity:60/232 - (25%)
Similarity:105/232 - (45%) Gaps:19/232 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IKQCHRNDPKLVDCFIGAIEHLKPYLA-NGIPDIQLPSVEPFKMDTLALQLT-EGPQGYKITLKN 87
            :..|..|.|.|.:|..|.|:...|.|. .|:|:..:.|::|:.......:.| :|.|| .:.:||
  Fly    85 VTPCSLNSPDLNECIRGLIQSFAPKLRYQGVPEFNMDSIDPYFYKRGIFRYTNDGIQG-GLLIKN 148

  Fly    88 MEAFGASNFKVTSLKLSEGSEPF--KAKIVMPKLKIEAKYTSS---GVLLILPASGGGDFHANFE 147
            ||.:|.|..:|.|:..:.....|  |..:.:|:||....:.:.   |.|.::|.   |.|:...:
  Fly   149 MEIYGISQLQVNSVAANFTDNGFIIKLGVELPQLKAGGHFKADVKFGGLRLVPK---GPFNITID 210

  Fly   148 GVSADLTGKTSIHAF-KGANYLHIDALSLVLDVKDVKMSISGAF---NNNRILLEATNLFLRENS 208
            .:.|.:.....|... .|...|.:..|:..:::.|.|:..:|.|   |.|.::|...|..|.|.:
  Fly   211 NIKATILTDGHIEQLPSGQQRLSLHRLNANVNIGDAKVVANGIFSDRNLNAMILNLVNENLPEIT 275

  Fly   209 QVVLEAMQAQLQKKLASEFGKLANQLLKNVPVEQFYV 245
            :|.:.|.:.|....|.:..    |:....||:|:|.|
  Fly   276 RVGIPATREQWAPILIAHI----NEFFAKVPIEKFLV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1124NP_649509.1 JHBP 6..244 CDD:284096 58/229 (25%)
CG16820NP_609627.1 JHBP 79..308 CDD:214779 59/230 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.