DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1124 and CG5945

DIOPT Version :9

Sequence 1:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster


Alignment Length:224 Identity:47/224 - (20%)
Similarity:99/224 - (44%) Gaps:9/224 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQLPSVEPFKMDTLALQLTEGPQGYKITLKNME 89
            :.:|...:.:|.:|.......|.|.|.:|.|::::...||..::..:.|.:.|....:||::|.:
  Fly    28 LPKCSTEEDQLGECVKQLFNTLTPRLKDGNPELRIEPYEPLHLNRTSFQYSSGTVNGRITVRNAK 92

  Fly    90 AFGASNFKVTSLKLSEGSEPFKAKIV--MPKLKIEAKYTSSGVLLILPASGGGDFHANFEGVSAD 152
            .:|.|:.:...:.:....:..|.::|  ||||.|...|.:...:..|.....|:|:.....|.|.
  Fly    93 IYGFSSNRAKEVSVKLNGDKVKLRLVTQMPKLNIVGSYKADMQVNQLQLKPKGEFNVTLLDVEAI 157

  Fly   153 LTGKTSIHAFKGANYLHIDALSLVLDVKDVKMSISGAFNN---NRILLEATNLFLRENSQVVLEA 214
            ......::...|..:..:..:.....:||:.:..:|.|.:   ::|.|...|.:.|:...::|..
  Fly   158 TVTDGEVYEKDGHRFFRLKNIDSKPKIKDLVIKANGIFADPELDKIALNVANQYWRDIYGIMLPE 222

  Fly   215 MQAQLQKKLASEFGKLANQLLKNVPVEQF 243
            .:...|..:...|    |:..:.||::||
  Fly   223 TRQFWQPLMLRMF----NEAFELVPIDQF 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1124NP_649509.1 JHBP 6..244 CDD:284096 47/224 (21%)
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 47/224 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470534
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.