DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1124 and dyw

DIOPT Version :9

Sequence 1:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster


Alignment Length:232 Identity:56/232 - (24%)
Similarity:106/232 - (45%) Gaps:13/232 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PPYIKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQLPSVEPFKMDTLALQLTEGPQG--YKIT 84
            |..:|:|...|.   .|.:...:.......||||:.|:.::||..:.|:.::.....:.  :|:|
  Fly    30 PSPLKRCKLQDE---SCLLAQAQTFFQAFKNGIPERQVAALEPIALGTMFIESGGHSESIKFKLT 91

  Fly    85 LKNMEAFG-ASNFKVTSLK--LSEGSEPFKAKIVM--PKLKIEAKYTSSGVLLILPASGGGDFHA 144
            :.:.:.:. |::..|.|||  ..:.:.|.|..:::  |:|::.|||...|.|||||....||...
  Fly    92 MSDAKLYNLANSMMVKSLKGFTKDLTRPLKLTLLLDNPELEVRAKYDVDGKLLILPIVSKGDLTI 156

  Fly   145 NFEGVSAD--LTGKTSIHAFKGANYLHIDALSLVLDVKDVKMSISGAFNNNRILLEATNLFLREN 207
            ....|...  :|.: .:....|..||:|........:|.....:|..||:|:.|.::|...|.:.
  Fly   157 RLNDVHTKVWITAE-PVKRSDGHTYLNITDYKTATKIKGGHFDLSNLFNDNKELRDSTLKVLNQE 220

  Fly   208 SQVVLEAMQAQLQKKLASEFGKLANQLLKNVPVEQFY 244
            ...:...:|.::.:..|..|..:...|..|:|.::|:
  Fly   221 WSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEFF 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1124NP_649509.1 JHBP 6..244 CDD:284096 55/230 (24%)
dywNP_570016.1 JHBP 29..258 CDD:214779 56/232 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.