DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2016 and CG17189

DIOPT Version :9

Sequence 1:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster


Alignment Length:264 Identity:59/264 - (22%)
Similarity:116/264 - (43%) Gaps:38/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MVFIVLVAVLGS--------TFAQEQPYYLQQCPRDEAQINECLRESGNKLVHYLQKGVPELD-- 59
            |:.|.|:.:|.:        .|..|:|.|::.|...|.:..:|...|....::.|.|||||::  
  Fly     1 MLLIGLLMLLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEES 65

  Fly    60 IYEIEPVMIDEIGIVLGSGPDGYRALFRN-----IQAYGVSNITVTNI-RSDLDSLQFQLTCEIP 118
            ...|:|:..::  :|..........|..|     |:.:|...|..:.: :.|...|   ....:|
  Fly    66 FGPIDPMRQEQ--LVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVSKKDFSWL---TKIYLP 125

  Fly   119 RIRVKAQYRSTGVLILVKASGAGDYWGEYEGV------KAKIYFKAVANEGPDGRTYLTTDSVKM 177
            ::|:...|:..|.::||...|.|....|.:.:      |.::|.|.       |.|:....|||:
  Fly   126 QMRIDGHYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKTRLYEKG-------GYTFYNVTSVKV 183

  Fly   178 DFNVKEIQMGVDNIANGNTVILLSSTEAALNLFINSNSQELLKEMKPALRTKLTLVIRNFMDRIF 242
            ..:|.:::..:||:.||::    ...|.:.|.|.|.|.:::.:.::|.:...:...:.:.:.:.|
  Fly   184 KVDVGKVRTRLDNLFNGHS----KEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTF 244

  Fly   243 AKIP 246
            |..|
  Fly   245 ALFP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 58/262 (22%)
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 54/241 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.