DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2016 and CG14259

DIOPT Version :9

Sequence 1:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster


Alignment Length:251 Identity:53/251 - (21%)
Similarity:109/251 - (43%) Gaps:36/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FAQEQPYYLQQCPRDEAQINECLRESGNKLVHYLQKGVPEL-------DIYEIEPVMI----DEI 71
            :..|:|.:|..|...|....:|...|..||:..|..|:||:       |...:..::.    :|:
  Fly    38 YYSEKPAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEVLERFGPFDPMRVRDIVFKQDNNEV 102

  Fly    72 GIVLGSGPDGYRALFRNIQAYGVSNITVTNIRSDLDSLQFQLTCEIPRIRVKAQYRSTGVLILVK 136
            ..:        ||...::...|.:|..|...|.......:|....:|::|:..:|...|.::|:.
  Fly   103 ATI--------RANLTDLVVKGFANTKVKESRVSKKDFSWQTKIYLPKMRLDGRYEMAGRILLIP 159

  Fly   137 ASGAGDYWGEYEGV------KAKIYFKAVANEGPDGRTYLTTDSVKMDFNVKEIQMGVDNIANGN 195
            .||:|..:.|.:.:      |.::|.|.       |.|:....:|::..|:.:::..:||:.||.
  Fly   160 LSGSGKIFIEIDDLDILLLTKIRLYEKG-------GFTFDNVTAVQVQLNLSKVRTYLDNLFNGR 217

  Fly   196 TVILLSSTEAALNLFINSNSQELLKEMKPALRTKLTLVIRNFMDRIFAKIPLDEWI 251
            :    ...|.:.|.|.|.|.::..:.:||.:...:..::.:.|..:|..||.:.::
  Fly   218 S----KEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIPANFFV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 53/249 (21%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 53/249 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470457
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.