DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2016 and CG13618

DIOPT Version :9

Sequence 1:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster


Alignment Length:250 Identity:59/250 - (23%)
Similarity:113/250 - (45%) Gaps:15/250 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MVFIVLVAVLGS----TFAQEQPYYLQQCPRDEAQINECLRESGNKLVHYLQKGVPELDIYEIEP 65
            ::.::|:|.:..    |.|||.|....:|.|| |..::||.::.|..:..|:.|..|..|..:||
  Fly     7 LLMLLLIAAVAQELTVTAAQELPEGFPKCKRD-ANFDKCLVDAVNVAIQQLKAGNREFGIPPLEP 70

  Fly    66 VMIDEIGIVLGSGPDGYRALFRNIQAYG-VSNITVTNIRSDLDSLQFQLTCEIPRIRVKAQYRST 129
            :.:.::.|..|:.|...|...:|::.:. :|...:...|:|||...........||.:...|..:
  Fly    71 LTVKKLVIDAGNAPINLRQALKNVKVHDMISTSKIQRYRTDLDKHLIICDSRTDRIEMIGDYEMS 135

  Fly   130 GVLILVKASGAGDYWGEYEGVKAKIYFKAVANE-GPDGRTYLTTDSVKMDFNVKEIQMGVDNIAN 193
            |.::|:..:|.|.  .....:..||..:.:... ..||..|:.....::.|:.|.:.|..:|:.|
  Fly   136 GRILLLPITGHGK--ANVTLINTKIEHRLIGEPFEKDGVKYMRLKDYRVSFDPKRVYMNFENLFN 198

  Fly   194 GNTVILLSSTEAALNLFINSNSQELLKEMKPALRTKLTLVIRNFMDRIFAKIPLD 248
            ..|:      ...:|.|:|.|.:.:..|:|........::.|...:::|.|:|.|
  Fly   199 DKTL------SDGMNRFLNENWETVFNELKVGYAKSFGIIFRELSNKLFEKVPFD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 58/247 (23%)
CG13618NP_651265.1 JHBP 13..251 CDD:284096 57/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470469
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.