DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2016 and CG15497

DIOPT Version :9

Sequence 1:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_650976.1 Gene:CG15497 / 42552 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster


Alignment Length:237 Identity:46/237 - (19%)
Similarity:98/237 - (41%) Gaps:28/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YYLQQCPRDEAQINECLRESGNKLVHYLQKGVPELDIYEIEPVMIDEIGIVLG--SGPDGYRALF 86
            :.|.:|...:...|||:|:..|.|..|...|||:.:|...:|.....:.:..|  .|...:|.:.
  Fly    41 HLLGRCHWSDEDFNECMRQVFNDLRAYFTTGVPDYNIKPFDPHHCSYVELRRGESQGLGSFRLIL 105

  Fly    87 RNIQAYGVSNITVTNIRSDLDSLQFQLTCEIPRIRVKAQYRSTGVLILVKASGAGDYWG----EY 147
            ||:..||.:...||...:|.:..:...|...|...::.:|.....::..:.:..| :|.    :|
  Fly   106 RNVSEYGWARSEVTKFHADPEDQRIVYTQYFPDKSLEGEYEFAAKMLGTEMNRKG-HWNLTLYDY 169

  Fly   148 EGVKAKIYFKAVANEGPDGRTYLTTDSV-KMDFNVKEIQMG--VDNIANGNTVILLSSTEAALNL 209
            ....:   .:.:...|...:.::..|.: .|:.:::.:..|  ::.:|:|               
  Fly   170 SQTTS---VRRIGGPGSLIKVHVEVDRIGGMELHIENLLQGQPLNQLADG--------------- 216

  Fly   210 FINSNSQELLKEMKPALRTKLTLVIRNFMDRIFAKIPLDEWI 251
            .|||..|..|..:||.:...::....:..:..|...||::::
  Fly   217 VINSMWQLGLPFIKPMINELVSTAFTDIFNESFRHFPLEKFL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 46/235 (20%)
CG15497NP_650976.1 JHBP 26..258 CDD:284096 46/235 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470572
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.