DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2016 and CG10407

DIOPT Version :9

Sequence 1:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster


Alignment Length:239 Identity:60/239 - (25%)
Similarity:124/239 - (51%) Gaps:18/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AQEQPYYLQQCPRDEAQINECLRESGNKLVHYLQKGVPELDIYEIEPVMIDEIGIVLGSGPDGYR 83
            |.:.|.:|:.|.|:...::.|:|||..:|...|.:|:|||.|..:||:::.::.:...||.....
  Fly    31 ADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLMEGIPELYIPAMEPLVVPQVKMDQDSGAIYLH 95

  Fly    84 ALFRNIQAYGVSNITVTNIRSDLDSLQFQLTCEIPRIRVKAQYRSTGVLILVKASG-------AG 141
            :::||::..|:|..||..:|.:...|:|.|:...|::.:::.|.     |.|...|       .|
  Fly    96 SVYRNVKVTGISKHTVNELRLEPSKLKFILSLTFPKLHMESDYS-----IKVSREGKIMMMPLLG 155

  Fly   142 DYWGEYEGVKAKIYFKAVANE-GPDGRTYLTTDSVKMDFNVKEIQMGVDNIANGNTVILLSSTEA 205
            |...:.:.|...:..:.:..| ..:|..:|..::||:.:.:.::.:.:||:.||:..:     ..
  Fly   156 DGHCKVDLVNITMRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKAL-----GD 215

  Fly   206 ALNLFINSNSQELLKEMKPALRTKLTLVIRNFMDRIFAKIPLDE 249
            .:|.|:|.|.:.|.:|::|.:...|..::|..:|::||....|:
  Fly   216 RMNEFLNENWKALAEEVRPLMTKALVDILRASVDKLFASFSYDD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 60/239 (25%)
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 60/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470463
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.