DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2016 and CG1124

DIOPT Version :9

Sequence 1:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster


Alignment Length:247 Identity:73/247 - (29%)
Similarity:138/247 - (55%) Gaps:6/247 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KMVFIVLVAVLGSTFAQEQPYYLQQCPRDEAQINECLRESGNKLVHYLQKGVPELDIYEIEPVMI 68
            |.|.:|:|.........|.|.|::||.|::.::.:|...:...|..||..|:|::.:..:||..:
  Fly     3 KAVCLVIVIQALRMVQAETPPYIKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQLPSVEPFKM 67

  Fly    69 DEIGIVLGSGPDGYRALFRNIQAYGVSNITVTNIRSDLDSLQFQLTCEIPRIRVKAQYRSTGVLI 133
            |.:.:.|..||.||:...:|::|:|.||..||:::....|..|:....:|:::::|:|.|:|||:
  Fly    68 DTLALQLTEGPQGYKITLKNMEAFGASNFKVTSLKLSEGSEPFKAKIVMPKLKIEAKYTSSGVLL 132

  Fly   134 LVKASGAGDYWGEYEGVKAKIYFKAVANEGPDGRTYLTTDSVKMDFNVKEIQMGVDNIANGNTVI 198
            ::.|||.||:...:|||.|.:..| .:.....|..||..|::.:..:||:::|.:....|.|.::
  Fly   133 ILPASGGGDFHANFEGVSADLTGK-TSIHAFKGANYLHIDALSLVLDVKDVKMSISGAFNNNRIL 196

  Fly   199 LLSSTEAALNLFINSNSQELLKEMKPALRTKLTLVIRNFMDRIFAKIPLDEW 250
            |     .|.|||:..|||.:|:.|:..|:.||........:::...:|::::
  Fly   197 L-----EATNLFLRENSQVVLEAMQAQLQKKLASEFGKLANQLLKNVPVEQF 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 71/244 (29%)
CG1124NP_649509.1 JHBP 6..244 CDD:284096 71/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.