DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2016 and CG14661

DIOPT Version :9

Sequence 1:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster


Alignment Length:250 Identity:61/250 - (24%)
Similarity:113/250 - (45%) Gaps:29/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MVFIVLVAVLGSTF-----AQEQPYYLQQCPRDEAQINECLRESGNKLVHYLQKGVPELDIYEIE 64
            |.|.::||.|...|     |...|.|:|.|.|::.::::||:.|.:.|..||.||:.||::..:|
  Fly     1 MQFQLIVASLLICFVACISAGNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELNVPPLE 65

  Fly    65 PVMIDEIGIVLGSGPDGYRALFRNIQAYGVSNITVTNIRSDLDSLQFQLTCEIPRIRVKAQYRST 129
            |:.|.::.|:.||.  |.....:.:...|.||..:|.:|:...:.:|.....:|.:.....|...
  Fly    66 PLYIGDLSILDGSA--GLTVKAKKLNILGASNFEITKLRASTQNRRFDFELILPHLHGDGLYEIN 128

  Fly   130 GVLILVKASGAGDYWGEYEG----VKAKIYFKAVANEGPDGRTYLTTDSVKMDFNVKEIQMGVDN 190
            |.::.:...|.|.:.|.:..    |:.:...|:|     :...||......:.....:..:.::|
  Fly   129 GNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSV-----NDLEYLHVKEFVLKIRTGKGNLKLEN 188

  Fly   191 IANGNTVILLSSTEAALNLFINSN----SQELLKEMKPALRTKL----TLVIRNF 237
            :.||:.|:     ...:|..||.|    :.:|:..:..||..|.    |.::.||
  Fly   189 LFNGDKVL-----GDVINDTINQNFEVFTNDLIAPIARALEAKFLVITTKILENF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 59/247 (24%)
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 56/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470456
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.