DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2016 and CG33680

DIOPT Version :9

Sequence 1:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster


Alignment Length:240 Identity:56/240 - (23%)
Similarity:96/240 - (40%) Gaps:61/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YYLQQCPRDEAQINECLRESGNK----LVH-YLQKGVPELDIYEIEPVMIDEIGIVLGSGPDGYR 83
            :.:..|.|:|..:..|:..:..:    ||| .|..|.|   ...:||:.:|.|.:.|.|   .::
  Fly    33 FTITPCARNEPLLERCIINAAYQIRPLLVHGNLGDGFP---TSPLEPLSLDNIELKLSS---QFQ 91

  Fly    84 ALFRNIQAYGVSNITVTNIRSDLDSLQFQLTCEIPRIRVKAQYRSTGVLILVKASGAGDYWGEYE 148
            |:|::::|.| .|.|                         .:|.....|:|....|.|:..|..|
  Fly    92 AVFKDLEANG-GNYT-------------------------GKYSLHLNLLLPDIKGKGNMQGYCE 130

  Fly   149 GVKAKIYFKAVANEGPDGRTYLTT--DSVK-------MDFNVKEIQMGVDNIANGNTVILLSSTE 204
            ..||.:..:        |..||..  |.||       :||  |:.::.:.|:.:|:..:     .
  Fly   131 NAKAFVKIR--------GSRYLRNGKDYVKFSKMTTLIDF--KDFKLKLANLFSGDRFL-----G 180

  Fly   205 AALNLFINSNSQELLKEMKPALRTKLTLVIRNFMDRIFAKIPLDE 249
            ...|..||:|.:..||::.|:|...|:....:..|:|.|....||
  Fly   181 DVGNSLINNNQELYLKDIAPSLEHGLSKHFLDVADKILASATFDE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 56/240 (23%)
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 56/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470466
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.