DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2016 and CG16820

DIOPT Version :9

Sequence 1:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster


Alignment Length:237 Identity:57/237 - (24%)
Similarity:113/237 - (47%) Gaps:31/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CPRDEAQINECLR---ESGNKLVHYLQKGVPELDIYEIEPVMIDEIGIVLGSGPDGYRA--LFRN 88
            |..:...:|||:|   :|....:.|  :||||.::..|:|..... ||...:. ||.:.  |.:|
  Fly    88 CSLNSPDLNECIRGLIQSFAPKLRY--QGVPEFNMDSIDPYFYKR-GIFRYTN-DGIQGGLLIKN 148

  Fly    89 IQAYGVSNITVTNIRSDLDSLQF--QLTCEIPRIRV----KAQYRSTGVLILVKASGAGDYWGEY 147
            ::.||:|.:.|.::.::.....|  :|..|:|:::.    ||..:..|:.::.|    |.:....
  Fly   149 MEIYGISQLQVNSVAANFTDNGFIIKLGVELPQLKAGGHFKADVKFGGLRLVPK----GPFNITI 209

  Fly   148 EGVKAKIYFKAVANEGPDGRTYLTTDSVKMDFNV---KEIQMGVDNIANGNTVILLSSTEAALNL 209
            :.:||.|.......:.|.|:..|:...:..:.|:   |.:..|:.:..|.|.:|        |||
  Fly   210 DNIKATILTDGHIEQLPSGQQRLSLHRLNANVNIGDAKVVANGIFSDRNLNAMI--------LNL 266

  Fly   210 FINSNSQELLKEMKPALRTKLTLVIRNFMDRIFAKIPLDEWI 251
             :|.|..|:.:...||.|.:...::...::..|||:|:::::
  Fly   267 -VNENLPEITRVGIPATREQWAPILIAHINEFFAKVPIEKFL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 57/235 (24%)
CG16820NP_609627.1 JHBP 79..308 CDD:214779 57/237 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.