DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2016 and CG5867

DIOPT Version :9

Sequence 1:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_609625.2 Gene:CG5867 / 34728 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster


Alignment Length:253 Identity:56/253 - (22%)
Similarity:106/253 - (41%) Gaps:41/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QEQPYYLQQCPRDEAQINECLRESGNKLVHYLQKGVPELDIYEIEPVMIDEIGIVLGSGPDGYRA 84
            :|.|..:..|...:..|:||:::...::...::.|:.||:|..::|..:.:......||....|.
  Fly    33 REIPGDIPTCREGDINISECIKQGLQQITPRMKYGISELNIPPLDPFEMGKSSYSYTSGLLQGRI 97

  Fly    85 LFRNIQAYGVSN--ITVTNIRSDLDSLQFQLTCEIPRIRVKAQYRSTGVLILVKASGAGDYWGEY 147
            ..:|:..:|:|.  :...|.|.....::.::...:|::.|:..|::...|..:|.:..|.:    
  Fly    98 SMKNVVIHGLSEGIVDKVNFRLKDGRVRMEILSHVPQMFVEGLYKADIKLNDLKLNPKGAF---- 158

  Fly   148 EGVKAKIYFKAVANEG--------PDGRTYLTTDSVKMDFNVKEIQMGVDNIANG-------NTV 197
                 .|....||...        .||.|||....::.:..|.:::.    .|||       |.|
  Fly   159 -----NITMTDVAMRARPIGELYERDGHTYLRLTKLETEPKVGDLKF----YANGLVPDPVLNDV 214

  Fly   198 ILLSSTEAALNLFINSNSQELLKEMKP-ALRTKLTLVIRNFMDRIFAKIPLDEWINLN 254
            ||         .|||...::|.:.|.| .|.|...|::::..| .||.:|.|..:..|
  Fly   215 IL---------DFINQYWRQLYQAMLPETLDTWQPLILKSTND-FFAALPFDMLVTKN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 55/248 (22%)
CG5867NP_609625.2 JHBP 34..260 CDD:214779 55/248 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470504
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.