DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2016 and CG3246

DIOPT Version :9

Sequence 1:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_608781.2 Gene:CG3246 / 33564 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster


Alignment Length:270 Identity:60/270 - (22%)
Similarity:118/270 - (43%) Gaps:44/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MVFIVLVAVLGS----TFAQEQPYYLQQCPRDEAQINECLRESGNK----------LVHYLQK-- 53
            ::.:|||.::.|    ..:||....::|   :.::.::.|:...::          |||:.|:  
  Fly     4 LIVVVLVGLMASGCHIVHSQEPGDAVEQ---EASESDDALKIKESQASIAAQVEAMLVHFQQEDP 65

  Fly    54 ----GVPELDIYEIEPVMIDEIGIVLGSGPDGYRALFRNIQAYGVSNITVTNIRSDLDSLQFQLT 114
                |||..|..|: |.:...:|:.        ....:.::|||:|...:..:..||..::|...
  Fly    66 QGLPGVPVPDPLEV-PNVKKSMGMA--------NLDMKQVKAYGLSKFRIDKMNLDLKEMRFNGG 121

  Fly   115 CEIPRIRVKAQYRSTGVLILVKASGAGDYWGEYEGVKAKIYFKAVANEGPDGRTYLTTDSVKMDF 179
            .::.::.||.||..:.  ...||:      |.:..|...:|.:|.|....:....|.||.:|:|.
  Fly   122 LQLDQMLVKGQYTLSS--FFSKAN------GPFTVVLKNVYAEATAFLAVERDGQLATDRIKIDI 178

  Fly   180 NVKEIQMGVDNIANGNTVILLSSTEAALNLFINSNSQELLKEMKPALRTKLTLVIRNFMD--RIF 242
            ...::.|...|:....:| ..|....|.||..::....:|:|....||:::.::|:..:.  |:.
  Fly   179 TFSDMTMDFQNLGLVGSV-FQSVVNGAPNLVFDAMKPFMLQEADKKLRSEINVMIQKTLGERRLP 242

  Fly   243 AKI-PLDEWI 251
            ..| |||..|
  Fly   243 NSITPLDSAI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 59/266 (22%)
CG3246NP_608781.2 JHBP 31..246 CDD:214779 49/235 (21%)
Grp7_allergen 260..418 CDD:293589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470505
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.