DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2016 and CG31207

DIOPT Version :9

Sequence 1:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_732581.1 Gene:CG31207 / 326125 FlyBaseID:FBgn0051207 Length:258 Species:Drosophila melanogaster


Alignment Length:264 Identity:64/264 - (24%)
Similarity:119/264 - (45%) Gaps:34/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGKMVFIVLVAVLGSTFAQEQPYYLQQCPRDEAQINECLRESGNKLVHYLQKGVPELDIYEIEP 65
            |...::.:||:.::||...|..|..:::|...:   ::|:..|.|.::....||:|.:.:..|:.
  Fly     1 MKDTIIVLVLLQIIGSLQGQILPKEIKKCRFGD---SKCIVNSMNAIIKNYPKGIPAIGLKPIDV 62

  Fly    66 VMIDEI----GIVLGSGPDGYRALFRNIQAYGVSNITVTNIRSDLD----SLQFQLTCEIPRIRV 122
            |.|.:.    ..::|:....: .||..:. ||..|.|:|.: |..|    |...::...||.:..
  Fly    63 VDIRDSKFWNDAMVGAFWLNF-DLFNQVN-YGFENTTITKV-SGFDENPTSSLIEIHGRIPSLIH 124

  Fly   123 KAQYRSTGVLILVKASGAGDYWGEYEGVKAKIYFKAVANEGPDGRTYL----TTDSVKMDFNVKE 183
            |..|.|.|.:.:|:.:..|:...:::..:..:..|.:. |..:.:.||    .|..|.||..|  
  Fly   125 KGDYFSMGRVWIVQMNSTGESLSDFQNFRFVLKLKVIM-EYRNNKRYLKIYELTPFVTMDRWV-- 186

  Fly   184 IQMGVDNIANGNTVILLSSTEAALNLFINSNSQELLKEMKPALRTKLTL---VIRNFMDRIFAKI 245
              ..:||....||.:.:     |:|...|.:..|...|::|   |.|.:   |.|:..:.||.|:
  Fly   187 --FWLDNFFESNTDMTI-----AINQVFNLHWVEFWNELEP---TNLKIFAGVFRSVFEDIFKKV 241

  Fly   246 PLDE 249
            |.|:
  Fly   242 PYDD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 63/258 (24%)
CG31207NP_732581.1 JHBP 7..248 CDD:284096 63/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470454
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.