DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14661 and CG13618

DIOPT Version :9

Sequence 1:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster


Alignment Length:254 Identity:71/254 - (27%)
Similarity:119/254 - (46%) Gaps:17/254 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QFQLIVASLLICFVA----CISAGNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELNVP 62
            ::.|::..|||..||    ..:|..:|:....|.| |....|||..:|:.....|..|.:|..:|
  Fly     3 KYSLLLMLLLIAAVAQELTVTAAQELPEGFPKCKR-DANFDKCLVDAVNVAIQQLKAGNREFGIP 66

  Fly    63 PLEPLYIGDLSILDGSAGLTVKAKKLNILGASNFEITKLRASTQNRRFDFE--LILPHLHGD--- 122
            |||||.:..|.|..|:|.:.::....|:........:|:    |..|.|.:  ||:.....|   
  Fly    67 PLEPLTVKKLVIDAGNAPINLRQALKNVKVHDMISTSKI----QRYRTDLDKHLIICDSRTDRIE 127

  Fly   123 --GLYEINGNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGNLK 185
              |.||::|.||.|||.|:|.......|.....|:..:....:.::|:.:|::.:.....:..:.
  Fly   128 MIGDYEMSGRILLLPITGHGKANVTLINTKIEHRLIGEPFEKDGVKYMRLKDYRVSFDPKRVYMN 192

  Fly   186 LENLFNGDKVLGDVINDTINQNFEVFTNDLIAPIARALEAKFLVITTKILENFTYSELF 244
            .||||| ||.|.|.:|..:|:|:|...|:|....|::....|..::.|:.|...:..:|
  Fly   193 FENLFN-DKTLSDGMNRFLNENWETVFNELKVGYAKSFGIIFRELSNKLFEKVPFDNIF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 70/246 (28%)
CG13618NP_651265.1 JHBP 13..251 CDD:284096 68/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470434
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.