DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14661 and CG17279

DIOPT Version :9

Sequence 1:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_650937.3 Gene:CG17279 / 42489 FlyBaseID:FBgn0038850 Length:245 Species:Drosophila melanogaster


Alignment Length:255 Identity:60/255 - (23%)
Similarity:110/255 - (43%) Gaps:35/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LICFVACI----SAGNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELNVPPLEPLYIGD 71
            ||.||.|:    |.|.:|..|:.|...|   |.|:..:|..:.....||:..:.:..|:.:...|
  Fly     3 LIVFVCCLWMAPSLGQLPPEIEKCRAGD---SICIAETVTRILRLYPKGLPSIGLVALDSIGFED 64

  Fly    72 LSIL----DGSAGLTVKAKKLNILGASNFEITKLRASTQNRRFDFEL--------ILPHLHGDGL 124
            :.:.    |||:...:|...|.::|.::..:|:.:.      ||.:|        .:|.|..:|.
  Fly    65 VVVSRLEPDGSSTFDLKFPNLTVIGFADSTVTEAKG------FDADLPRVLELSGWIPLLKLNGT 123

  Fly   125 YEINGNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLE-----YLHVKEFVLKIRTGKGNL 184
            ||:.|::|.:||.|.|.....    :...||:..::.:.||.     |..:.:....:.....:|
  Fly   124 YEMRGSLLTMPIHGKGQAKVE----IRECRVRCKVRVLEDLRDDGKLYAGISKVKCLLDVQGMHL 184

  Fly   185 KLENLFNGDKVLGDVINDTINQNFEVFTNDLIAPIARALEAKFLVITTKILENFTYSELF 244
            .||||||..: :.|.:|...|..:....::|...|..|::.....|..::.....|.:|:
  Fly   185 NLENLFNNPE-MSDAMNVVANTKWLEIWHNLRRGITSAVDQLVESILQRVANKLPYDDLY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 60/255 (24%)
CG17279NP_650937.3 JHBP 5..243 CDD:336447 57/251 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26928
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.