DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14661 and CG31189

DIOPT Version :9

Sequence 1:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster


Alignment Length:243 Identity:59/243 - (24%)
Similarity:109/243 - (44%) Gaps:18/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CFVACISAGNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELNVPPLEPLYIGDLSILD- 76
            |....||..::|:.::.||..|   |.||..|::.|..:..|||.|:.:|||:.....|..|:: 
  Fly    13 CIPVMISGASLPEDVEKCHFGD---STCLVRSINALIKHYPKGIPEIGLPPLDAYNFPDSVIMES 74

  Fly    77 ---GSAGLTVKAKKLNILGASNFEITKLRA---STQNRRFDFELILPHLHGDGLYEINGNILALP 135
               |...:..:.:.....|.:|..||.:..   ....::...::.||.|..:..|:::|.:|...
  Fly    75 PSRGPIWMDFRMRDNVNKGFNNATITHVEGFLYEPNQKQIVLKVRLPRLVHEATYDMSGRVLLFF 139

  Fly   136 IKGNGPFTGNFTNFVAYVRVQYDIKSV----NDLEYLHVKEFVLKIRTGKGNLKLENLFNGDKVL 196
            ....|....:|.||    |:...||::    ||..||.:...|..:...:..:.|:.|:..:..:
  Fly   140 FNTTGRLISDFQNF----RITLTIKALVEYRNDKRYLKIYNLVPSLDLDRWIIWLDGLYKENTDV 200

  Fly   197 GDVINDTINQNFEVFTNDLIAPIARALEAKFLVITTKILENFTYSELF 244
            ...:|...|:|:..|.|||...:.:|....|.|:..::.:|..|.::|
  Fly   201 TIFMNKLFNENWVEFWNDLQPGLVKAFTNAFTVLLNRVFDNVAYDDMF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 59/243 (24%)
CG31189NP_732580.3 JHBP 9..249 CDD:284096 59/243 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470418
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26928
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.