DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14661 and CG1124

DIOPT Version :9

Sequence 1:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster


Alignment Length:240 Identity:68/240 - (28%)
Similarity:121/240 - (50%) Gaps:7/240 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ICFVACISAGNM-----PDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELNVPPLEPLYIGD 71
            :|.|..|.|..|     |.||:.||||||:|..|...::.:|:||||.||.::.:|.:||..:..
  Fly     5 VCLVIVIQALRMVQAETPPYIKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQLPSVEPFKMDT 69

  Fly    72 LS--ILDGSAGLTVKAKKLNILGASNFEITKLRASTQNRRFDFELILPHLHGDGLYEINGNILAL 134
            |:  :.:|..|..:..|.:...|||||::|.|:.|..:..|..::::|.|..:..|..:|.:|.|
  Fly    70 LALQLTEGPQGYKITLKNMEAFGASNFKVTSLKLSEGSEPFKAKIVMPKLKIEAKYTSSGVLLIL 134

  Fly   135 PIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGNLKLENLFNGDKVLGDV 199
            |..|.|.|..||....|.:..:..|.:.....|||:....|.:......:.:...||.:::|.:.
  Fly   135 PASGGGDFHANFEGVSADLTGKTSIHAFKGANYLHIDALSLVLDVKDVKMSISGAFNNNRILLEA 199

  Fly   200 INDTINQNFEVFTNDLIAPIARALEAKFLVITTKILENFTYSELF 244
            .|..:.:|.:|....:.|.:.:.|.::|..:..::|:|....:.:
  Fly   200 TNLFLRENSQVVLEAMQAQLQKKLASEFGKLANQLLKNVPVEQFY 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 68/240 (28%)
CG1124NP_649509.1 JHBP 6..244 CDD:284096 68/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.