DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14661 and CG33680

DIOPT Version :9

Sequence 1:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster


Alignment Length:226 Identity:65/226 - (28%)
Similarity:101/226 - (44%) Gaps:39/226 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELNVP--PLEPLYIGDLSILDGSAGLTVKAKKLN 89
            |..|.||:|.|.:|:.::.:.:||.|..|......|  |||||.:.::                 
  Fly    35 ITPCARNEPLLERCIINAAYQIRPLLVHGNLGDGFPTSPLEPLSLDNI----------------- 82

  Fly    90 ILGASNFEITKLRASTQNRRFDFELILPHLHGD-----GLYEINGNILALPIKGNGPFTGNFTNF 149
                      :|:.|:|     |:.:...|..:     |.|.::.|:|...|||.|...|...|.
  Fly    83 ----------ELKLSSQ-----FQAVFKDLEANGGNYTGKYSLHLNLLLPDIKGKGNMQGYCENA 132

  Fly   150 VAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGNLKLENLFNGDKVLGDVINDTINQNFEVFTND 214
            .|:|:::......|..:|:...:....|......|||.|||:||:.||||.|..||.|.|::..|
  Fly   133 KAFVKIRGSRYLRNGKDYVKFSKMTTLIDFKDFKLKLANLFSGDRFLGDVGNSLINNNQELYLKD 197

  Fly   215 LIAPIARALEAKFLVITTKILENFTYSELFP 245
            :...:...|...||.:..|||.:.|:.|:||
  Fly   198 IAPSLEHGLSKHFLDVADKILASATFDEMFP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 63/224 (28%)
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 63/224 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470439
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.