DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14661 and CG16820

DIOPT Version :9

Sequence 1:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster


Alignment Length:237 Identity:54/237 - (22%)
Similarity:100/237 - (42%) Gaps:31/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ISAGNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLA-KGIKELNVPPLEPLYIGDLSIL----DG 77
            :|:|:  :.:..|..|.|:|::|::..:.:..|.|. :|:.|.|:..::| |.....|.    ||
  Fly    78 LSSGS--NEVTPCSLNSPDLNECIRGLIQSFAPKLRYQGVPEFNMDSIDP-YFYKRGIFRYTNDG 139

  Fly    78 -SAGLTVKAKKLNILGASNFEITKLRASTQNRRFDFEL--ILPHLHGDGLYEINGNILALPIKGN 139
             ..||.:  |.:.|.|.|..::..:.|:..:..|..:|  .||.|...|.::.:.....|.:...
  Fly   140 IQGGLLI--KNMEIYGISQLQVNSVAANFTDNGFIIKLGVELPQLKAGGHFKADVKFGGLRLVPK 202

  Fly   140 GPFTGNFTNFVAYVRVQYDIKSV-NDLEYLHVKEFVLKIRTGKGNLKLENLFNGDKVLGDVINDT 203
            |||.....|..|.:.....|:.: :..:.|.:......:..|...:....:|: |:.|..:|.:.
  Fly   203 GPFNITIDNIKATILTDGHIEQLPSGQQRLSLHRLNANVNIGDAKVVANGIFS-DRNLNAMILNL 266

  Fly   204 INQNFEVF-------TNDLIAPI---------ARALEAKFLV 229
            :|:|....       |.:..|||         |:....||||
  Fly   267 VNENLPEITRVGIPATREQWAPILIAHINEFFAKVPIEKFLV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 54/237 (23%)
CG16820NP_609627.1 JHBP 79..308 CDD:214779 52/234 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470499
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.