DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14661 and CG5867

DIOPT Version :9

Sequence 1:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_609625.2 Gene:CG5867 / 34728 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster


Alignment Length:269 Identity:66/269 - (24%)
Similarity:109/269 - (40%) Gaps:56/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VASLLICFVACISA------------GNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKEL 59
            |.:|::....|::|            ..:|..|..|...|..:|:|:|..:..:.|.:..||.||
  Fly     7 VVALILMAGLCLAAEIELPPVEFKPVREIPGDIPTCREGDINISECIKQGLQQITPRMKYGISEL 71

  Fly    60 NVPPLEPLYIGDLS------ILDGSAGLTVKAKKLNILGASNFEITKLRASTQNRRFDFELI--L 116
            |:|||:|..:|..|      :|.|    .:..|.:.|.|.|...:.|:....::.|...|::  :
  Fly    72 NIPPLDPFEMGKSSYSYTSGLLQG----RISMKNVVIHGLSEGIVDKVNFRLKDGRVRMEILSHV 132

  Fly   117 PHLHGDGLYEINGNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGK 181
            |.:..:|||:.:..:..|.:...|.|....|:.....|...::...:...||.:.:  |:.....
  Fly   133 PQMFVEGLYKADIKLNDLKLNPKGAFNITMTDVAMRARPIGELYERDGHTYLRLTK--LETEPKV 195

  Fly   182 GNLKLENLFNG---DKVLGDVINDTINQNFEVF-------------------TNDLIAPIARALE 224
            |:||.  ..||   |.||.|||.|.|||.:...                   |||..|.:     
  Fly   196 GDLKF--YANGLVPDPVLNDVILDFINQYWRQLYQAMLPETLDTWQPLILKSTNDFFAAL----- 253

  Fly   225 AKFLVITTK 233
             .|.::.||
  Fly   254 -PFDMLVTK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 65/266 (24%)
CG5867NP_609625.2 JHBP 34..260 CDD:214779 60/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.