DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14661 and CG3246

DIOPT Version :9

Sequence 1:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_608781.2 Gene:CG3246 / 33564 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster


Alignment Length:247 Identity:50/247 - (20%)
Similarity:91/247 - (36%) Gaps:41/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VACISAGNMPDYIQVCHRNDP---------ELSKCLKSSVHNLRPYLAKGIKEL----------- 59
            :..:..|.|.....:.|..:|         |....||  :...:..:|..::.:           
  Fly     5 IVVVLVGLMASGCHIVHSQEPGDAVEQEASESDDALK--IKESQASIAAQVEAMLVHFQQEDPQG 67

  Fly    60 --NVPPLEPLYIGDLSILDGSAGLTVKAKKLNILGASNFEITKLRASTQNRRFDFELILPHLHGD 122
              .||..:||.:.::....|.|.|.:  |::...|.|.|.|.|:....:..||:..|.|..:...
  Fly    68 LPGVPVPDPLEVPNVKKSMGMANLDM--KQVKAYGLSKFRIDKMNLDLKEMRFNGGLQLDQMLVK 130

  Fly   123 GLYEINGNILALPIKGNGPFT----GNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGN 183
            |.|.::    :...|.|||||    ..:....|::.|:.|.:...|    .:|   :.|......
  Fly   131 GQYTLS----SFFSKANGPFTVVLKNVYAEATAFLAVERDGQLATD----RIK---IDITFSDMT 184

  Fly   184 LKLENLFNGDKVLGDVINDTINQNFEVFTNDLIAPIARALEAKFLVITTKIL 235
            :..:||.....|...|:|...|..|:.....::....:.|.::..|:..|.|
  Fly   185 MDFQNLGLVGSVFQSVVNGAPNLVFDAMKPFMLQEADKKLRSEINVMIQKTL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 50/247 (20%)
CG3246NP_608781.2 JHBP 31..246 CDD:214779 46/221 (21%)
Grp7_allergen 260..418 CDD:293589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.