DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14661 and CG31207

DIOPT Version :9

Sequence 1:NP_001246918.1 Gene:CG14661 / 40611 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_732581.1 Gene:CG31207 / 326125 FlyBaseID:FBgn0051207 Length:258 Species:Drosophila melanogaster


Alignment Length:249 Identity:53/249 - (21%)
Similarity:100/249 - (40%) Gaps:16/249 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVASLLICFVACISAGNMPDYIQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELNVPPLEPLYIG 70
            |:..:|:..:..:....:|..|:.|...|   |||:.:|::.:.....|||..:.:.|::.:.|.
  Fly     5 IIVLVLLQIIGSLQGQILPKEIKKCRFGD---SKCIVNSMNAIIKNYPKGIPAIGLKPIDVVDIR 66

  Fly    71 DLSILDGSAGLTVKAKKLNI-------LGASNFEITKLRASTQNRRFDFELI---LPHLHGDGLY 125
            |....:.:   .|.|..||.       .|..|..|||:....:|.......|   :|.|...|.|
  Fly    67 DSKFWNDA---MVGAFWLNFDLFNQVNYGFENTTITKVSGFDENPTSSLIEIHGRIPSLIHKGDY 128

  Fly   126 EINGNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGNLKLENLF 190
            ...|.:..:.:...|....:|.||...::::..::..|:..||.:.|....:...:....|:|.|
  Fly   129 FSMGRVWIVQMNSTGESLSDFQNFRFVLKLKVIMEYRNNKRYLKIYELTPFVTMDRWVFWLDNFF 193

  Fly   191 NGDKVLGDVINDTINQNFEVFTNDLIAPIARALEAKFLVITTKILENFTYSELF 244
            ..:..:...||...|.::..|.|:|.....:.....|..:...|.:...|.::|
  Fly   194 ESNTDMTIAINQVFNLHWVEFWNELEPTNLKIFAGVFRSVFEDIFKKVPYDDMF 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14661NP_001246918.1 JHBP 10..245 CDD:399529 52/245 (21%)
CG31207NP_732581.1 JHBP 7..248 CDD:284096 52/247 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470410
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.