DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and RAD6

DIOPT Version :9

Sequence 1:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_011457.1 Gene:RAD6 / 852822 SGDID:S000003026 Length:172 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:104/151 - (68%)
Similarity:130/151 - (86%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65
            |||||||||||||||::||.|.|||.:|..:|:|:|||:|.||.|||:|||||:|.:||.|||||
Yeast     1 MSTPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPN 65

  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLY 130
            |||.|:|:|::|||||||:|.||||||||||:|||||::||||||||.:||||.||||..||.|:
Yeast    66 KPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLF 130

  Fly   131 KENRREYEKRVKACVEQSFID 151
            |:::.:|.||||..||:|:.|
Yeast   131 KDHKSQYVKRVKETVEKSWED 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 93/136 (68%)
RAD6NP_011457.1 COG5078 1..150 CDD:227410 103/148 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 208 1.000 Domainoid score I516
eggNOG 1 0.900 - - E2759_KOG0419
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I740
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54755
OrthoFinder 1 1.000 - - FOG0001694
OrthoInspector 1 1.000 - - oto99400
orthoMCL 1 0.900 - - OOG6_101178
Panther 1 1.100 - - LDO PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1583
SonicParanoid 1 1.000 - - X1087
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.