DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc6 and UBC1

DIOPT Version :10

Sequence 1:NP_524230.2 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_010462.3 Gene:UBC1 / 851757 SGDID:S000002584 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:135 Identity:51/135 - (37%)
Similarity:82/135 - (60%) Gaps:2/135 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RRLMRDFKRLQEDPPTGVS-GAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTV 70
            :|:|::.:.:::||...:: ...::::|........||..||:|.|.|.:.||...|||.|||.:
Yeast     5 KRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKM 69

  Fly    71 RFVSKVFHPNVYA-DGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENR 134
            :|.:||:|||:.: .|.||||||:|.|||...:.:.|.|:|:||..|.||.|.::..||.|..:|
Yeast    70 QFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDR 134

  Fly   135 REYEK 139
            ..:.|
Yeast   135 ESFNK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc6NP_524230.2 UBCc_UBE2A_2B 3..145 CDD:467410 51/135 (38%)
UBC1NP_010462.3 UBCc_UBE2K 4..147 CDD:467420 51/135 (38%)
UBA_3 161..215 CDD:117832
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.